SecReT6
Protein ID: 374300590
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2244
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2488181..2489914 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDF3YX72
KEGG IDdaf:Desaf_2244
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.70E-174, Aligned region: 2..577
Protein Sequence: 577 a.a.     [Download]
>gi|374300590|ref|YP_005052229.1| type VI secretion protein [Desulfovibrio africanus str. Walvis Bay]
MLNRFFQQELSHLRDLAAEFSRLHPALAPMLSGPTKDPDVERLLEGTAFLTGLLRCKLDDDFPELIHGLA
QLTFPHSLRPVPSTSMVVFAPKPNLKETMRIPAGTALASIPVEGTKCLFRTCYDLDVHPLKLTSAKLAER
TGGSRSIQLSLQLSGLALNKWRPKSLRLHVSGQYAEATNLFELLLTRTERIVVRPLDGGSPLVLPPIRIK
SAGFGRDEALLPYPSQAFPGYRIIQEYFTLPEKFLFLDISGLDGWQDPGAGSRFEIHFELGQIPNDLPRV
GAESFQLFATPVVNVFTHDAAPIRLDHRASEYRILPEGGSSAQYQVFSVEKVVGIAQGSVKTREYTPFEI
MKPSSTGNPVHYVNRRISPVSGLTEVLLSVAYPPGELPPERETLAVSLLCTNAQLPERLRLGDINQPTST
SPELCEFRNIRQPTPQVEPPMGHDQLWRLLSHMTLNLMSLADASNLREILKLSVHPSGRDRTLFEGNMKR
LDGIEKLSVKAADRLVRGLLVRGNELSLTLNPDSFASRGDMYLFGCILDYFLGTYAQINTFTQLSVQDAL
KGDTYRWPARAGDKPLI
 
Nucleotide Sequence: 1734 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2488181-2489914 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGCTCAACAGGTTTTTCCAGCAGGAGCTGTCCCATCTGAGGGACTTGGCGGCCGAGTTCTCCCGGCTGC
ATCCCGCCTTGGCCCCCATGCTCAGCGGTCCGACCAAGGACCCGGACGTGGAGCGGCTGCTCGAAGGCAC
GGCCTTCCTGACCGGGCTTCTGCGCTGCAAGCTAGACGACGATTTTCCCGAGCTGATCCATGGCCTCGCG
CAGCTGACCTTCCCGCACAGCCTGCGGCCAGTGCCGTCGACCTCAATGGTCGTCTTCGCTCCCAAGCCGA
ACCTCAAGGAGACGATGCGCATTCCGGCCGGCACGGCGCTCGCTTCCATTCCGGTCGAGGGAACCAAGTG
CCTTTTCCGGACCTGCTACGATCTCGATGTCCACCCGCTGAAGCTGACTTCGGCCAAGCTCGCCGAACGG
ACCGGGGGCAGCAGGTCCATCCAGCTTTCCTTGCAGCTTTCGGGGCTTGCCTTGAACAAATGGCGGCCGA
AGTCGCTCCGGCTGCATGTGTCCGGCCAGTACGCGGAGGCCACGAACCTCTTCGAGCTGCTGCTGACCCG
CACCGAGCGCATCGTGGTCCGGCCCCTGGACGGGGGCTCGCCCCTGGTCCTCCCTCCGATCCGCATAAAG
TCCGCCGGCTTTGGCCGGGACGAGGCGCTGCTGCCCTATCCGTCGCAAGCGTTTCCCGGCTACCGCATCA
TCCAGGAGTACTTCACCCTGCCGGAGAAGTTCCTCTTCCTGGACATAAGCGGACTGGACGGGTGGCAAGA
CCCTGGAGCGGGGAGCCGGTTCGAGATCCACTTCGAGCTGGGCCAGATTCCCAATGATCTGCCCAGGGTG
GGCGCGGAGAGCTTCCAGCTCTTCGCCACGCCGGTAGTCAACGTGTTCACCCACGACGCAGCTCCCATCC
GTCTCGACCATCGGGCAAGCGAGTATCGAATCCTGCCGGAGGGCGGCAGCAGCGCACAGTACCAGGTTTT
TTCCGTGGAGAAGGTCGTGGGAATAGCCCAGGGCTCGGTCAAGACCAGAGAGTATACGCCGTTCGAGATC
ATGAAGCCCTCCAGTACAGGGAACCCGGTCCATTACGTTAATCGCAGGATCTCACCGGTGAGCGGCCTGA
CAGAGGTGCTCCTCTCGGTTGCCTATCCTCCGGGCGAGCTGCCGCCTGAACGCGAGACGCTCGCCGTCAG
CCTGCTATGCACCAATGCGCAGCTCCCCGAACGGCTCAGGCTGGGCGACATCAACCAGCCGACCTCGACT
TCGCCGGAACTGTGCGAGTTCAGGAACATCCGCCAGCCGACCCCCCAGGTCGAGCCGCCCATGGGCCACG
ATCAGCTCTGGCGTCTGCTGTCCCACATGACCCTCAACCTCATGTCGCTGGCCGACGCCTCGAACCTGAG
GGAGATCCTCAAGCTCTCCGTCCATCCGTCGGGCCGCGACCGCACGCTCTTCGAGGGGAACATGAAGCGG
CTGGACGGCATCGAGAAGCTGTCGGTCAAGGCCGCGGACCGGCTCGTGCGCGGCCTGCTCGTGCGCGGCA
ACGAACTCAGTCTGACCCTCAACCCGGACAGTTTCGCCAGCCGGGGGGACATGTACCTCTTCGGCTGCAT
ACTCGACTATTTCCTGGGCACATACGCGCAGATCAACACATTCACACAGCTGTCCGTGCAGGACGCGCTC
AAAGGGGATACCTACCGATGGCCGGCGAGAGCAGGCGACAAGCCCCTGATCTGA