SecReT6
Protein ID: 374300591
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2245
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2489878..2490945 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDF3YX73
KEGG IDdaf:Desaf_2245
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.40E-77, Aligned region: 21..320
Protein Sequence: 355 a.a.     [Download]
>gi|374300591|ref|YP_005052230.1| type VI secretion protein [Desulfovibrio africanus str. Walvis Bay]
MAGESRRQAPDLKGDLLGQGRSYSFIQAVRLLRLLEQDGRGADPESFLAGKIMARPLLSLGFPATDISSI
EELGEGQASFYRITATFMGLYGASSPLPTFYTEDLLDEASEDSSISRDFLDILNTPFYRLFYRCWSKYRW
WTKIYDEQDPEYVGRLLCLVGLGHDGLRSKLPFAFRLLRYAGLLTQFPRSALGLATLLADALNIPSLSVV
PLIPRRVRIPQDQVCRLGAQATTLGEDCHLGSETMDCMSAFRITTGPLTEDRYHGLLSGEPDAVLLGSLV
EFYLQQPLECDLELSLARDQVQPARLGEDTWSRLGEDTWMFCGQYPEAAAAARFPVEQGQSSARIHHRQQ
EGCCT
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2489878-2490945 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGGCCGGCGAGAGCAGGCGACAAGCCCCTGATCTGAAGGGCGACCTCCTCGGGCAGGGCCGTTCGTACT
CCTTTATCCAGGCGGTGCGGCTGCTCAGGCTCCTGGAGCAGGATGGAAGGGGTGCGGACCCCGAGAGTTT
CCTGGCCGGGAAGATCATGGCCCGGCCGTTGCTCTCCCTCGGCTTCCCGGCCACGGACATCAGCTCCATC
GAGGAACTCGGGGAGGGACAGGCGTCCTTCTACCGGATCACGGCGACGTTCATGGGCCTCTACGGAGCCT
CCTCGCCGCTGCCGACGTTCTACACCGAGGATCTCCTGGACGAGGCCTCGGAGGATTCCTCCATCAGCAG
GGATTTTCTGGATATCCTGAATACGCCCTTCTACCGTTTGTTCTATCGCTGCTGGAGCAAGTACCGCTGG
TGGACGAAGATTTACGATGAACAGGACCCCGAGTACGTGGGGCGGCTTCTGTGCCTCGTCGGATTGGGCC
ACGATGGGCTCCGCAGCAAGCTGCCCTTCGCCTTCCGGCTGCTGCGCTATGCCGGGCTGCTCACGCAGTT
TCCCAGGTCGGCCCTGGGCCTTGCGACCCTGCTGGCGGACGCGCTGAACATTCCCAGCCTAAGCGTTGTC
CCGCTCATCCCCCGGCGGGTGCGCATCCCGCAGGATCAGGTCTGCCGCCTCGGCGCGCAGGCCACCACGC
TTGGCGAGGACTGCCACCTGGGCAGCGAGACCATGGACTGCATGTCCGCGTTCCGCATCACCACCGGACC
GCTCACCGAGGATCGCTACCATGGCCTGCTTTCCGGCGAGCCAGACGCCGTGCTGCTGGGCAGTCTGGTC
GAGTTCTACCTCCAGCAGCCGCTCGAGTGCGATCTGGAGTTGAGCCTGGCCCGGGACCAGGTCCAGCCGG
CCCGGCTGGGCGAAGACACCTGGTCGAGGCTTGGCGAGGACACCTGGATGTTTTGCGGTCAATACCCGGA
AGCCGCGGCCGCGGCGCGCTTCCCGGTGGAACAGGGCCAGTCGTCAGCGCGGATTCATCATCGCCAACAG
GAAGGTTGCTGCACATGA