SecReT6
Protein ID: 374300592
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2246
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2490942..2493566 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDF3YX74
KEGG IDdaf:Desaf_2246
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-41, Aligned region: 222..239
AAA_2 [PF07724], Evalue: 1.80E-41, Aligned region: 523..571
AAA_2 [PF07724], Evalue: 1.80E-41, Aligned region: 606..771
AAA [PF00004], Evalue: 1.40E-18, Aligned region: 222..327
AAA [PF00004], Evalue: 1.40E-18, Aligned region: 611..718
AAA_16 [PF13191], Evalue: 6.00E-15, Aligned region: 199..237
AAA_16 [PF13191], Evalue: 6.00E-15, Aligned region: 264..300
AAA_16 [PF13191], Evalue: 6.00E-15, Aligned region: 487..487
AAA_16 [PF13191], Evalue: 6.00E-15, Aligned region: 581..651
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 222..245
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 610..728
ClpB_D2-small [PF10431], Evalue: 2.10E-13, Aligned region: 780..852
AAA_22 [PF13401], Evalue: 1.90E-08, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.90E-08, Aligned region: 608..703
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 222..296
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 601..628
Arch_ATPase [PF01637], Evalue: 3.10E-05, Aligned region: 200..236
Arch_ATPase [PF01637], Evalue: 3.10E-05, Aligned region: 274..305
Arch_ATPase [PF01637], Evalue: 3.10E-05, Aligned region: 606..623
Arch_ATPase [PF01637], Evalue: 3.10E-05, Aligned region: 681..692
IstB_IS21 [PF01695], Evalue: 5.10E-05, Aligned region: 216..251
IstB_IS21 [PF01695], Evalue: 5.10E-05, Aligned region: 610..643
IstB_IS21 [PF01695], Evalue: 5.10E-05, Aligned region: 806..821
Sigma54_activat [PF00158], Evalue: 7.10E-05, Aligned region: 221..281
Sigma54_activat [PF00158], Evalue: 7.10E-05, Aligned region: 592..727
AAA_19 [PF13245], Evalue: 9.40E-05, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 9.40E-05, Aligned region: 608..633
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 217..239
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 468..506
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 609..650
AAA_18 [PF13238], Evalue: 0.00028, Aligned region: 222..241
AAA_18 [PF13238], Evalue: 0.00028, Aligned region: 611..645
RuvB_N [PF05496], Evalue: 0.00082, Aligned region: 221..236
RuvB_N [PF05496], Evalue: 0.00082, Aligned region: 275..302
RuvB_N [PF05496], Evalue: 0.00082, Aligned region: 570..628
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 216..238
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 606..635
AAA_14 [PF13173], Evalue: 0.0032, Aligned region: 222..312
AAA_14 [PF13173], Evalue: 0.0032, Aligned region: 609..699
AAA_17 [PF13207], Evalue: 0.0077, Aligned region: 222..271
AAA_17 [PF13207], Evalue: 0.0077, Aligned region: 609..645
Protein Sequence: 874 a.a.     [Download]
>gi|374300592|ref|YP_005052231.1| type VI secretion ATPase, ClpV1 family [Desulfovibrio africanus str. Walvis Bay]
MIDVDIKALLSRLGPFSTTALQNAAGLCVSRTNYEVTVEHFFLKCLDDAGSDMPLILRRFAIDQGRLSEA
LLDSLEDFKAGNASRPVFSPLLIELFEAAWLIASLELCETRIRSAAVLLAFLAKPAFFGSGRWMDMVREI
SRDALKAELGNLLKGSTEGAAPAPGSGAKDGAPAGAEDFLAKYCTDFTAKAREGKIDPVFGRDAEIRQIV
DILARRRKNNPILVGDPGVGKTAVMEGLALRVVEGDVPESLTGVTLLGLEMGALEAGAGMKGEFERRLQG
LLNAVKASERPIILFIDEAHTLIGAGGATGGSDAANLLKPALARGEIKTCAATTWSEYKKYFEKDAALAR
RFQLVRLEEPSVQTAALILRGLRDSYEKCHKVVIRDDAMEAAAVFSDRYISGRFLPDKAIDLLDTSCARV
KVNLTAKPAVLEDKERSIQALEREKRALDRDLANGVAVDKERQEMIVKRIGEFTAQAEEIRQRWLKEQEA
AKAVLALRAQLHDVGQDGKSQFENLKARLADADKALAELQKDDPLIRIEVCPDLVAQVVSDWTGIPLGKV
QRDEAQTIIHLEDRLKARIRGQDHALESLAHVIRAAKSGIKNPNQPMGVFLLVGPSGVGKTETGLALAEL
LFGGEKSVVTINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRRNPYSVVLLDEVEKAHVDVLNIFY
QVFDKGMLADGEGKVINFKNTVIMLTSNLGTDVIQEMAPGEERPPSEAVMAAVRPILSQHFKPALLARMT
VIPYYSLPPSAMRLIVELKLGKLRQTLMDNNRMAMTWADAVSDQITARCTEVETGARNIEYILNGNVLPQ
MSQMILSHMSEGGMPAKVHLDVAGDGGFSMVFGA
 
Nucleotide Sequence: 2625 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2490942-2493566 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGATCGATGTTGACATCAAGGCCCTGCTCTCCAGGCTCGGCCCTTTTTCCACCACCGCGCTGCAGAACG
CCGCGGGCCTGTGCGTCTCCAGGACCAACTACGAGGTCACGGTGGAGCACTTCTTTCTTAAGTGCCTGGA
TGATGCCGGCAGCGACATGCCGCTCATCCTGCGGCGTTTTGCCATCGACCAGGGCCGTTTGTCCGAGGCT
CTGCTGGATTCCCTGGAGGACTTCAAGGCCGGCAACGCCTCCAGGCCGGTATTCTCGCCGCTGCTCATTG
AACTGTTTGAGGCTGCCTGGCTGATCGCCTCCCTGGAGCTCTGCGAGACGCGCATCCGCTCGGCCGCGGT
TCTGCTGGCCTTCCTGGCCAAGCCGGCCTTTTTCGGCAGCGGCCGATGGATGGACATGGTCAGAGAGATC
AGCCGCGACGCCCTCAAGGCAGAGCTCGGCAATCTACTCAAGGGCTCGACCGAGGGAGCTGCCCCGGCTC
CGGGTTCGGGGGCCAAGGATGGAGCGCCGGCGGGCGCCGAGGACTTCCTGGCCAAGTACTGCACCGACTT
CACGGCCAAGGCCAGGGAGGGCAAGATCGACCCGGTTTTTGGCCGCGACGCCGAGATCCGCCAGATCGTG
GACATCCTGGCCCGGCGGCGCAAGAATAACCCGATCCTGGTCGGTGATCCGGGCGTGGGCAAGACCGCGG
TCATGGAGGGCTTGGCACTGCGCGTCGTGGAAGGCGATGTGCCCGAATCGTTGACCGGCGTCACGCTGCT
GGGCCTCGAAATGGGAGCCCTGGAGGCCGGCGCGGGCATGAAGGGCGAGTTCGAGCGGCGGCTGCAGGGA
TTGCTGAACGCGGTCAAGGCCTCTGAACGGCCGATCATCCTGTTCATCGACGAGGCCCATACCCTGATCG
GCGCGGGTGGCGCGACCGGCGGCTCGGATGCGGCCAACCTGCTCAAGCCGGCCCTGGCCAGGGGTGAAAT
CAAGACCTGCGCGGCCACGACATGGTCGGAGTACAAGAAGTACTTCGAGAAGGACGCGGCCTTGGCCCGG
CGTTTTCAGCTCGTGAGGCTCGAGGAGCCGAGCGTCCAAACCGCGGCCCTCATCCTGCGGGGACTGCGCG
ACTCCTACGAGAAGTGCCACAAGGTCGTCATCCGGGATGACGCCATGGAGGCCGCGGCCGTGTTCTCCGA
CCGCTACATCTCCGGCCGATTCCTGCCGGACAAGGCCATCGATCTCCTGGACACCAGCTGTGCCAGGGTC
AAGGTCAACCTCACGGCCAAGCCTGCGGTCCTGGAGGACAAGGAACGGTCAATCCAGGCCCTAGAGCGGG
AGAAGAGAGCGCTCGATCGCGACCTTGCCAACGGCGTGGCCGTGGACAAGGAGCGCCAAGAGATGATCGT
CAAGCGCATCGGGGAATTTACGGCCCAAGCCGAGGAGATCCGGCAGCGCTGGCTCAAGGAGCAGGAGGCG
GCCAAGGCGGTTCTGGCTTTGCGCGCCCAACTCCATGATGTGGGCCAGGACGGCAAGAGCCAGTTCGAGA
ATCTTAAGGCCAGGCTTGCCGACGCTGACAAGGCCCTGGCCGAGCTGCAGAAGGATGATCCGCTCATCCG
CATCGAGGTCTGCCCGGACCTGGTGGCCCAAGTGGTCTCGGACTGGACAGGCATCCCGCTCGGCAAGGTC
CAGCGGGACGAGGCCCAGACCATCATCCACCTGGAGGATCGGCTAAAAGCCAGGATCAGAGGTCAGGACC
ACGCCCTTGAGTCCCTGGCTCACGTCATCCGGGCGGCCAAGTCAGGAATCAAAAACCCGAACCAGCCAAT
GGGCGTGTTCCTGCTCGTGGGCCCGAGCGGCGTGGGCAAGACCGAGACCGGGCTGGCCCTGGCCGAACTG
CTCTTTGGCGGCGAGAAGAGCGTGGTGACCATCAACATGAGCGAGTTCCAGGAGAAGCACACTGTGAGCC
GGCTCATCGGCTCGCCGCCGGGCTACGTGGGCTACGGCGAGGGCGGCATGCTCACCGAGGCGGTGCGCCG
CAACCCATATTCGGTCGTGCTCCTGGACGAAGTCGAAAAGGCCCACGTCGACGTCCTGAACATCTTCTAC
CAGGTCTTCGACAAGGGCATGCTCGCCGATGGCGAGGGCAAGGTCATCAACTTCAAGAACACGGTCATCA
TGCTCACGAGCAACCTTGGCACGGACGTCATCCAGGAGATGGCCCCTGGCGAGGAGCGGCCGCCGTCGGA
AGCTGTCATGGCCGCGGTAAGGCCGATCCTGTCCCAGCATTTCAAGCCGGCCCTGCTCGCGCGCATGACC
GTGATCCCTTACTACTCCCTGCCGCCGTCGGCCATGAGGCTGATCGTCGAGCTCAAGCTCGGCAAGCTCC
GCCAGACGCTCATGGATAACAACCGCATGGCCATGACCTGGGCCGATGCCGTATCCGACCAGATCACGGC
CCGCTGCACCGAAGTCGAGACCGGCGCGCGCAACATTGAATACATCCTGAACGGCAATGTCCTGCCCCAG
ATGTCCCAGATGATCCTTTCGCACATGAGCGAAGGCGGCATGCCCGCCAAGGTCCATCTGGACGTGGCCG
GGGACGGCGGGTTCTCAATGGTCTTCGGAGCCTAG