SecReT6
Protein ID: 374300594
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2248
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2494399..2496678 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDF3YX76
KEGG IDdaf:Desaf_2248
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 30..330
Phage_base_V [PF04717], Evalue: 1.20E-16, Aligned region: 381..472
Protein Sequence: 759 a.a.     [Download]
>gi|374300594|ref|YP_005052233.1| Rhs element Vgr protein [Desulfovibrio africanus str. Walvis Bay]
MGFHKDCYFDFRCEGLPQETFDVVEFKGLEGLSTPYMFEVTLVSPNPDIDLTEVVRSRSTLVLLREAGEE
VLFHGILAAFEQTLAYNTAYFYRAVLRPAFWRLSLTHHNQVFLGKSVPEILQTVLKDGGLATDEFELRLT
GNYAPCEYVCQYQESHFDFVSRWMEREGIYYFFEQGPDREKLVLTDTASAHVLAAKGGKFSYSQTSGLDH
ASRTEVVKSFTCRQQMLPAKVKLKDYNYLRPSLDLTVEAAVSERGMGEVYLYGEHFLTPEAGSRLARIRA
EELMAGEKRFLGESLIPYLLPGFVFDLQGHFRKDTNARYLTTDIEHEGNQVALLPAAAKDGLGTLATEPY
YRNSFTAIPAGVQFRPQRKTEKARFHGSLSAVIDAETDSPYAELDEHGRYKVRLPFDIGGSRAGKASHRL
RMVQPYVGSNHGMHFPLHKGTEVLLTFIDGDPDRPVISGAVPNPDNPSPVTSDNLTKNVITSAGGNTIHM
EDQEGSQRILLHSPATGTFVRLGAPNDPPPLLRSDQDHDKDKDKDDKTTDDKKEEPEEEEMFGIKLFSAG
GMEVSVQSKHEVIMGENTETILGIDYLNRLLSANDITVGLLTEIKLAGVLEYDTEKHKFVIAKDEIAEEK
AELTNTLQRLSTQYTQLAAQKSELAGEVNKLAGGQTQLYGEVSKLAGIEEELITDVQKIAANTTFTSGLT
QALVGQSLRTIGSQTEAIGVATRSMGEKTDFVGTNVVMASESVRIALEDQELAQLKLLI
 
Nucleotide Sequence: 2280 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2494399-2496678 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGGGATTCCACAAGGATTGCTACTTCGACTTCCGCTGCGAGGGTCTGCCTCAGGAGACCTTCGACGTAG
TCGAATTCAAGGGCCTCGAGGGGCTGTCCACGCCCTACATGTTCGAGGTCACGCTCGTCTCGCCCAACCC
CGATATCGACCTGACCGAGGTCGTGCGCAGCCGCTCAACGCTCGTGCTTTTGCGCGAGGCGGGCGAGGAG
GTGCTTTTTCACGGCATCCTGGCCGCCTTCGAGCAGACCCTGGCCTACAACACGGCCTACTTCTACCGGG
CCGTGCTTCGGCCGGCCTTCTGGCGGCTGTCGCTCACCCATCATAACCAGGTATTCCTGGGCAAGAGCGT
GCCGGAGATCCTGCAGACCGTGCTCAAGGACGGCGGGCTGGCCACGGACGAGTTCGAGCTGCGTTTGACC
GGCAACTACGCGCCCTGCGAGTACGTCTGCCAATACCAGGAGAGCCACTTCGATTTCGTGTCGCGCTGGA
TGGAGCGAGAAGGCATCTACTACTTCTTCGAGCAGGGCCCGGACCGGGAGAAGCTCGTGCTGACCGACAC
GGCCTCGGCCCACGTGCTGGCGGCCAAGGGCGGCAAGTTCTCCTACTCCCAGACCTCGGGCCTGGACCAC
GCCTCCCGCACGGAGGTCGTCAAGAGCTTCACCTGCCGCCAGCAGATGCTCCCGGCCAAGGTCAAGCTCA
AGGACTATAACTACCTCAGGCCCTCGCTCGACCTCACGGTCGAGGCTGCGGTTTCGGAGCGGGGCATGGG
CGAGGTGTACCTGTACGGCGAGCACTTCCTGACCCCGGAGGCGGGCAGCCGCCTGGCGCGCATCAGGGCC
GAGGAGCTGATGGCCGGCGAGAAGCGTTTTTTGGGCGAGAGCCTCATCCCCTACCTGCTGCCGGGCTTCG
TCTTTGATCTTCAGGGCCATTTCCGCAAGGATACGAACGCCCGCTACCTGACGACCGACATCGAGCACGA
GGGCAACCAGGTCGCGCTGTTGCCGGCCGCGGCCAAGGACGGATTGGGCACGCTGGCCACGGAGCCATAC
TACCGCAACAGCTTCACGGCCATCCCGGCCGGGGTCCAGTTCAGGCCGCAGCGCAAGACCGAGAAGGCTC
GTTTCCACGGCAGCCTCAGCGCGGTGATCGACGCCGAGACGGACAGCCCCTACGCCGAGCTCGACGAGCA
CGGCCGCTACAAGGTCAGGCTGCCCTTCGACATAGGCGGGAGCAGAGCCGGCAAGGCCTCCCACCGCCTG
CGCATGGTCCAGCCCTATGTCGGTTCGAACCACGGCATGCATTTCCCCCTGCACAAGGGCACCGAGGTGC
TGCTGACCTTCATCGACGGCGACCCGGACCGGCCGGTCATCTCCGGCGCCGTGCCCAACCCGGACAACCC
GAGCCCGGTCACGTCCGACAACCTGACCAAGAACGTGATCACCTCGGCCGGCGGCAACACGATCCACATG
GAGGACCAGGAGGGCTCCCAGCGCATCCTTCTGCACTCTCCGGCGACTGGAACCTTTGTCCGCCTGGGCG
CTCCCAACGACCCGCCCCCGCTTCTGCGCTCGGATCAGGACCATGACAAGGATAAGGATAAGGACGACAA
GACTACGGATGATAAAAAAGAGGAACCTGAAGAAGAGGAGATGTTCGGCATCAAGCTTTTCAGCGCGGGT
GGGATGGAGGTCTCGGTGCAGAGCAAGCATGAGGTCATCATGGGCGAGAACACCGAGACCATCTTGGGCA
TAGATTATCTGAATAGGCTCCTCTCGGCCAACGACATCACCGTGGGGCTGTTGACGGAGATAAAGCTCGC
CGGCGTGCTTGAATACGACACCGAGAAGCACAAATTCGTCATCGCCAAGGATGAGATAGCGGAGGAAAAG
GCTGAGCTGACGAACACTCTCCAAAGACTGTCAACACAATACACGCAGTTGGCCGCGCAGAAAAGCGAGT
TGGCCGGCGAGGTGAACAAGTTGGCGGGCGGTCAGACTCAGCTTTACGGCGAGGTATCAAAACTCGCTGG
GATCGAGGAGGAACTCATCACAGACGTTCAAAAAATTGCGGCTAATACCACCTTTACAAGCGGCCTGACA
CAAGCGCTTGTGGGCCAATCCCTCAGAACGATAGGCTCACAAACCGAGGCTATCGGGGTGGCTACCAGAT
CCATGGGAGAGAAAACCGACTTCGTCGGAACAAACGTCGTGATGGCGAGTGAAAGCGTGCGCATAGCTCT
GGAGGATCAGGAGTTGGCGCAGCTGAAGCTGTTGATCTAG