SecReT6
Protein ID: 374310879
SecReT6 ID924
T6SS typeiii
Gene symbol-
Locus tagAciX8_1948
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]2285519..2286022 [+]
Producthypothetical protein
NoteTssB
UniProt IDG8NST6
KEGG IDgma:AciX8_1948
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 0.0001, Aligned region: 49..149
Protein Sequence: 167 a.a.     [Download]
>gi|374310879|ref|YP_005057309.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MPIIEVKRQSVRTAVRKVPTSTTAIPMPMTAERVGTELRSDSEEPVVVESLEDAFAKFKPGLKFRSAQRE
DGVTFQADLRFESVKDFEPANLMARREIKAEDGSVTSPRNDLADLKNNIDLLYRLKDRWRLPAVRRAWSD
PQERKQMIEALDKLREELEKVSERETK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|374308961|ref|NC_016631.1|:2285519-2286022 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGCCGATTATCGAGGTCAAGCGACAAAGCGTACGGACTGCCGTACGAAAGGTGCCGACCAGCACCACTG
CGATTCCCATGCCGATGACGGCGGAACGCGTAGGTACGGAGTTGCGCAGCGATAGTGAAGAGCCGGTAGT
CGTGGAATCGCTCGAAGATGCCTTTGCGAAGTTTAAGCCGGGGTTGAAGTTTCGCAGCGCGCAGAGAGAG
GACGGCGTTACCTTTCAGGCGGACCTGCGCTTTGAAAGCGTGAAGGATTTCGAGCCAGCGAACCTCATGG
CTCGGCGTGAGATCAAGGCCGAGGACGGATCGGTAACGTCTCCCAGAAACGATCTCGCCGACCTCAAGAA
CAATATCGATCTGCTGTATCGGCTCAAGGATCGCTGGCGTTTGCCGGCAGTGCGCCGCGCGTGGTCTGAC
CCTCAGGAGCGGAAGCAGATGATCGAAGCGCTGGACAAGCTCCGTGAAGAGCTTGAGAAAGTATCCGAGA
GGGAGACGAAATAA