SecReT6
Protein ID: 374310880
SecReT6 ID924
T6SS typeiii
Gene symbol-
Locus tagAciX8_1949
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]2286022..2287365 [+]
Producthypothetical protein
NoteTssC
UniProt IDG8NST7
KEGG IDgma:AciX8_1949
PDB IDNA
Domain hit(s) vs Pfam Phage_sheath_1 [PF04984], Evalue: 0.0085, Aligned region: 257..402
Protein Sequence: 447 a.a.     [Download]
>gi|374310880|ref|YP_005057310.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MATATRTPHEILEANETRDVMLEIFAELHPGLIDEDRTIDSIFTPRTARDFITQLVSVTDLLEEEDSFDE
TLFKLQDLIDQAEKLRDELLEEVYTYLRPIERSYLQLQIFFENCKVYDGKQRKPVELYIWNTDPKKIQGI
FSVTIAAIESFCRRRNDNFNFRDDICNLVIPGMISQPVRERLESIANQWGILLITDIDDEKSFQNVERNF
RPGGKYEFLKRPEDRAAADVVVMGYLQLRPRHWFERTLDGGDDLYGPPSLAFAGAVARTDDAVGMAQGPV
GSRFGQVTGPGKARIEPLIGEMEHLSMERQLIPIIRDADNKLCFFGCRTLADDPYGVYKFFTSYRIIRYV
ERCCRHHLLQVAGQVLTRDFIDEAIERPITKMLQEQVEAGTLIDFKLEIDKDTAKRMQGVCDLKLEVIPT
GPGETFRLKIDTPDFAPDAAAQQTVVR
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|374308961|ref|NC_016631.1|:2286022-2287365 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGGCAACCGCCACGCGTACTCCCCACGAAATTCTGGAAGCGAACGAGACCCGGGACGTGATGCTTGAGA
TCTTCGCCGAGCTCCATCCCGGCCTGATCGATGAAGATCGCACGATCGACTCGATCTTTACACCGCGCAC
GGCACGCGATTTCATCACTCAGCTCGTGAGCGTGACAGATCTCCTTGAAGAGGAGGATTCCTTCGACGAG
ACACTGTTCAAGCTGCAGGACTTGATCGACCAGGCCGAAAAGCTGCGAGACGAGCTTCTCGAAGAGGTCT
ACACCTATCTGCGCCCGATAGAGAGAAGTTACCTGCAGTTGCAGATCTTCTTCGAAAACTGCAAGGTGTA
TGACGGCAAGCAGCGTAAGCCGGTTGAGCTTTATATCTGGAACACCGATCCGAAGAAGATTCAGGGCATC
TTCAGCGTTACGATCGCGGCGATAGAGAGTTTCTGCCGGAGGCGGAACGACAACTTCAACTTCCGCGACG
ACATCTGCAATCTGGTGATCCCTGGCATGATCAGCCAGCCGGTTCGGGAGCGTCTTGAAAGTATTGCGAA
TCAGTGGGGCATTCTGTTGATCACCGACATTGACGATGAAAAGTCATTCCAGAATGTCGAGCGCAACTTC
CGGCCTGGCGGCAAGTACGAATTCCTGAAGCGTCCCGAGGACCGCGCTGCTGCAGATGTTGTTGTCATGG
GCTACCTTCAGCTGCGCCCACGCCATTGGTTTGAGCGCACACTCGACGGTGGCGACGATCTTTATGGGCC
GCCTTCGCTGGCGTTTGCCGGCGCAGTGGCACGTACCGACGATGCCGTCGGCATGGCGCAGGGACCGGTG
GGCTCGCGCTTCGGCCAGGTGACTGGTCCGGGGAAGGCGCGCATTGAGCCGCTGATCGGGGAGATGGAAC
ATCTGAGCATGGAGCGGCAGCTCATTCCGATCATCCGTGACGCGGATAACAAACTTTGCTTCTTCGGTTG
CCGCACGCTGGCGGACGACCCCTACGGCGTCTACAAGTTCTTTACCTCCTATCGCATCATCCGCTACGTC
GAGCGTTGCTGCCGCCATCATCTGCTGCAGGTGGCAGGGCAGGTGCTTACGCGCGACTTTATCGATGAAG
CGATCGAAAGGCCCATCACGAAGATGCTGCAGGAGCAGGTAGAGGCGGGAACTCTCATCGACTTCAAGCT
GGAGATTGATAAGGATACCGCCAAGCGGATGCAGGGCGTATGCGATCTCAAGCTTGAGGTTATACCTACG
GGCCCCGGAGAAACGTTCCGGCTCAAGATCGACACGCCCGACTTTGCCCCGGACGCCGCAGCTCAACAGA
CCGTCGTTCGCTGA