SecReT6
Protein ID: 374310882
SecReT6 ID924
T6SS typeiii
Gene symbol-
Locus tagAciX8_1951
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]2287923..2289605 [+]
Producthypothetical protein
NoteTssF
UniProt IDG8NST9
KEGG IDgma:AciX8_1951
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 560 a.a.     [Download]
>gi|374310882|ref|YP_005057312.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MNASVAEIDLQLRDEFRRHLGEYGIEWTAIDPVLAVMFRTLAHQIGSITSNTNALRAALLGELLDGLNLD
RRFAQPSQTIVAYRCEQESAEIAAGTELIGKPEKGGSSSFLADYGISVSPARIAGVFVYEKESLRLLSGM
ALPEETALAEPSYDAAPARLGSFPCIYIAIENLAPSHLSRHGLFLQISPDAALLHAQLRRENWCFASSSG
RFTERGLMRPSPLNGGQLRFDWLLNSGRSVPEASSNDEIPTLPGGFWQGRCFVLPQVPADNDFSCRQPLG
MEAPLRQIFRRYALFDKPRAWLRIRLDPRIEPLHTSLTAAHLHAQSASNVQLLHQTVRFAENGTTIPLNP
EGRSKLFLVSGMSIAGESGSTYLPEYGQGVHAGAGRYRLDQQRITLTPGKMEDGQPESYANVRLWMTEGR
EGNGMGAARLNSFAKPTWTSGLFVANLTSSAGGTDGEALHVARRRFAEVLLSRERLLTRTDLETAVRSFD
TRISAVDVTPRTVRGLRGGLRRVYHLSLHAERERFVEGEEESRIMLVELRSFLAERVPLDVELSMELAWA
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|374308961|ref|NC_016631.1|:2287923-2289605 Granulicella mallensis MP5ACTX8 chromosome, complete genome
GTGAACGCAAGCGTTGCCGAGATCGACCTTCAGCTTCGAGACGAGTTTCGCCGGCATCTTGGCGAATACG
GCATAGAGTGGACGGCGATAGATCCGGTGCTCGCCGTGATGTTTCGCACGCTTGCGCATCAGATCGGTTC
CATCACCTCGAATACCAACGCCTTGCGTGCCGCGCTACTGGGCGAACTGCTCGACGGATTGAACCTCGAT
CGCCGCTTTGCACAGCCGTCGCAAACCATCGTTGCCTACCGCTGCGAGCAGGAGTCCGCGGAGATCGCCG
CGGGAACCGAGCTGATTGGAAAGCCCGAGAAGGGGGGCAGCAGCAGCTTCCTGGCCGACTATGGAATTTC
TGTCTCGCCGGCTCGTATCGCCGGGGTATTTGTCTACGAGAAAGAATCGCTGCGGCTGTTGAGCGGCATG
GCACTACCTGAGGAAACAGCCCTTGCCGAGCCGAGTTATGACGCGGCGCCGGCGCGTCTCGGTAGCTTCC
CATGCATTTATATCGCCATCGAGAACCTGGCGCCGTCGCACCTCTCCCGGCATGGGCTCTTTCTGCAGAT
CAGCCCGGATGCCGCTTTGCTGCATGCGCAGCTTCGGCGCGAGAACTGGTGTTTCGCATCTTCCTCGGGG
CGCTTCACTGAGCGAGGTCTCATGCGGCCGAGCCCGCTCAATGGAGGACAGCTTCGTTTTGACTGGTTGC
TGAATTCAGGCAGGAGTGTTCCTGAAGCAAGCAGCAATGACGAAATCCCTACGCTGCCGGGGGGCTTCTG
GCAGGGACGATGCTTCGTGCTTCCGCAGGTTCCTGCCGACAATGATTTTTCCTGCCGTCAGCCGCTTGGC
ATGGAAGCTCCGTTGCGGCAGATCTTTCGGCGTTATGCGCTCTTCGACAAGCCTCGGGCGTGGCTGCGAA
TCCGGCTCGATCCGCGCATCGAGCCGCTCCATACTTCCCTGACAGCAGCTCACCTGCACGCGCAAAGCGC
TTCGAACGTGCAACTCCTGCATCAGACGGTTCGTTTTGCTGAGAACGGGACTACGATTCCGCTGAATCCC
GAAGGTCGGAGCAAGTTGTTTCTGGTCTCCGGGATGAGCATTGCAGGTGAAAGTGGCTCGACCTATCTGC
CTGAGTATGGGCAAGGCGTGCACGCAGGAGCTGGCCGCTATCGCCTGGACCAGCAGCGGATCACCTTGAC
GCCCGGAAAGATGGAGGACGGTCAACCCGAGAGCTATGCCAATGTGAGGCTTTGGATGACCGAGGGTCGT
GAAGGCAATGGCATGGGGGCGGCGCGTCTGAACAGCTTTGCCAAGCCCACTTGGACCTCCGGGCTGTTTG
TTGCGAATCTGACTTCCAGTGCAGGAGGCACGGATGGGGAAGCGTTGCACGTTGCCAGGCGTCGCTTTGC
AGAGGTGCTTCTTTCGCGCGAGCGGCTCCTTACCCGCACGGATCTGGAGACCGCTGTACGCTCCTTCGAT
ACCCGTATTAGCGCAGTCGACGTAACACCCCGTACCGTGCGCGGTCTCCGCGGTGGCCTGCGGAGGGTCT
ATCACCTTTCGCTTCATGCGGAGCGGGAGCGCTTCGTAGAGGGTGAAGAAGAGTCCCGGATCATGCTTGT
GGAACTACGCTCCTTTCTGGCGGAGCGCGTGCCGCTGGACGTGGAACTGAGCATGGAGCTTGCGTGGGCA
TGA