SecReT6
Protein ID: 374310883
SecReT6 ID924
T6SS typeiii
Gene symbol-
Locus tagAciX8_1952
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]2289602..2290501 [+]
Producthypothetical protein
NoteTssG
UniProt IDG8NSU0
KEGG IDgma:AciX8_1952
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 0.00041, Aligned region: 75..100
DUF1305 [PF06996], Evalue: 0.00041, Aligned region: 197..294
PASTA [PF03793], Evalue: 0.00057, Aligned region: 20..74
Protein Sequence: 299 a.a.     [Download]
>gi|374310883|ref|YP_005057313.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MIPASIVMPDFQTPTAGFAHSVDSALLVLERLGVPDARITLLMAGAGRPDLTVVKQSPPPGTPLLSTTRV
ALSIAGFGFFHALPLSMRESGTEHEMGTREICRAFDSPVEKLARWFRAGAPMFAFSEQHPETCLPWLALF
GIDASRWPEDLWFRLSLLMPALARLGGRQSGIKLTMHLLFDLPLHSVESFPTYRSYGQISGLGERSSRLG
EDWIAGDGMRDVDGIRLRLGPVPLVRYRYFQDSIGSELLRMACGLCLSAYQDYKIAWLIEDQNLIPVLGD
EMKNGRLGVNFHLGRGMKS
 
Nucleotide Sequence: 900 bp     [Download]
>gi|374308961|ref|NC_016631.1|:2289602-2290501 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGATTCCTGCAAGCATCGTCATGCCGGACTTTCAGACCCCGACCGCGGGTTTTGCGCACTCGGTCGATT
CGGCGCTTCTTGTGTTGGAACGGCTCGGTGTCCCCGACGCACGCATCACGTTGCTGATGGCTGGTGCCGG
GCGGCCGGACCTCACTGTGGTGAAGCAGTCGCCGCCACCGGGAACACCCTTGCTTTCGACCACGCGCGTC
GCGCTTTCTATCGCCGGCTTCGGGTTCTTTCATGCCTTGCCGCTGTCGATGCGCGAGTCCGGCACCGAAC
ATGAGATGGGCACCCGAGAGATCTGCCGCGCCTTCGACAGCCCGGTTGAAAAGCTGGCCCGCTGGTTCCG
GGCTGGCGCGCCGATGTTTGCCTTTTCAGAGCAGCATCCCGAGACCTGCCTGCCATGGCTGGCGCTGTTT
GGGATCGACGCGTCGCGCTGGCCGGAAGACCTGTGGTTTCGCCTGTCGCTTCTGATGCCTGCGCTGGCGC
GGCTCGGTGGCCGCCAAAGCGGCATCAAGCTGACCATGCACCTGCTGTTCGATCTGCCCCTGCATTCCGT
CGAGAGTTTTCCCACGTACCGAAGCTATGGCCAGATCTCAGGGCTGGGCGAGCGCTCCAGCCGGCTTGGC
GAGGATTGGATTGCGGGCGATGGCATGCGGGATGTGGACGGGATCAGGTTACGCCTGGGCCCCGTGCCGC
TCGTGCGATACAGGTACTTCCAGGACAGCATCGGCAGCGAATTGCTCAGGATGGCGTGCGGCCTTTGCCT
TAGCGCCTATCAGGACTACAAAATTGCCTGGCTCATCGAAGACCAGAACCTTATTCCCGTGCTTGGGGAT
GAGATGAAGAACGGCAGGCTCGGCGTCAACTTCCACCTAGGGAGAGGGATGAAATCATGA