SecReT6
Protein ID: 374310884
SecReT6 ID924
T6SS typeiii
Gene symbol-
Locus tagAciX8_1953
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]2290498..2292171 [+]
Producthypothetical protein
NoteTssK
UniProt IDG8NSU1
KEGG IDgma:AciX8_1953
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-08, Aligned region: 79..223
Protein Sequence: 557 a.a.     [Download]
>gi|374310884|ref|YP_005057314.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MNSQETYKPAVNWEFGMLVTPEHFVRQERFHEASLLWMLRYTSKDFGLVGGGLRLPEALSGVGRHDPIVQ
ITQDEESLQITVSQCRGLTPSGTPVEITPETAVTRRFALSDLGGKKQLRIYLLVPPHEYVAVDGAADEHN
PQMQTERVRSCKLTLEPHGEALDHALMVGALRLRDQGLAYEIDSRFFPPCLHMGALSELTVSWRSMVDLL
AVLSGRFMQLHRAMQEYIEMARERGIDSRLDDETLIFVRSVIPLLDDSLEECLDITQSPGRFLGHLRKLT
HGAALHLSLSPPVRQYFDALRSGGEAEFAPALDRLTQILQADRRRWQSDDLAKELQNAERALRGIEVLER
ALEGKYIDFRVSPMLESMNFFFDRGGSALYKLAAKPARLQGFGDQMTFYFANIRLEGREKYRLILTAHAA
GSFDSQEQIPVELGMNEGSGTRRAPLHGVASVRTEGQNNVEFDFDAPEVQTIVDLRVTVPSRFPVSGVLL
FVRHRFYMGEAPETKAEAPREELATAFRPPLQPGGPPVNNRPSSVARKEEQYIDAPIAGTRRRRLEE
 
Nucleotide Sequence: 1674 bp     [Download]
>gi|374308961|ref|NC_016631.1|:2290498-2292171 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGAATTCACAAGAAACATATAAGCCGGCGGTGAACTGGGAGTTCGGAATGCTGGTTACTCCCGAGCATT
TCGTCAGGCAGGAACGCTTTCATGAAGCCTCTCTGCTTTGGATGCTTCGGTATACCTCCAAGGATTTCGG
GCTGGTGGGCGGAGGCCTGCGGCTGCCTGAAGCGCTAAGCGGGGTTGGCCGCCACGACCCCATCGTTCAG
ATCACCCAGGATGAGGAATCTCTGCAGATCACGGTGTCGCAGTGCCGCGGGCTTACGCCATCCGGAACGC
CCGTCGAGATCACACCCGAGACAGCGGTAACGCGGCGCTTTGCATTATCCGATCTGGGTGGCAAAAAGCA
ACTTCGTATCTACCTGCTGGTTCCACCTCACGAGTACGTCGCTGTCGACGGGGCGGCAGACGAGCACAAT
CCGCAGATGCAGACCGAACGGGTGCGTTCCTGCAAGCTGACCCTGGAGCCGCACGGAGAAGCTCTGGATC
ACGCCCTGATGGTGGGTGCATTGAGACTTCGCGATCAGGGGCTTGCCTATGAGATCGATTCCCGGTTTTT
CCCGCCATGTCTGCACATGGGCGCATTGAGCGAACTGACCGTAAGCTGGCGTTCCATGGTTGATCTGCTG
GCTGTGTTATCCGGACGCTTCATGCAATTGCATCGCGCCATGCAGGAATACATCGAGATGGCGCGCGAGC
GTGGCATCGATAGCCGGTTGGATGACGAGACGCTGATCTTCGTGCGTTCCGTCATTCCACTGCTCGATGA
CAGCCTGGAAGAATGCCTGGACATCACGCAATCTCCCGGGCGATTTCTCGGCCACCTGCGCAAGCTTACG
CACGGCGCGGCGCTGCATCTGAGCCTGAGTCCACCGGTAAGGCAGTACTTCGACGCTCTGCGGAGCGGTG
GAGAAGCGGAGTTTGCGCCTGCACTCGATCGTCTGACCCAGATCCTGCAAGCAGACCGGCGTCGATGGCA
GTCGGATGACCTCGCTAAGGAGTTGCAAAATGCAGAGCGCGCGCTTCGCGGCATTGAAGTGCTGGAGCGA
GCATTGGAAGGCAAGTACATCGACTTCCGTGTCAGCCCCATGCTCGAAAGCATGAACTTCTTCTTCGACC
GCGGAGGAAGTGCTCTCTACAAGCTCGCCGCCAAGCCTGCGCGGCTACAGGGCTTCGGAGACCAGATGAC
GTTTTACTTTGCCAATATTCGACTCGAAGGGCGCGAAAAGTACCGGCTGATTTTGACGGCTCATGCGGCG
GGTAGCTTTGACTCACAGGAGCAGATTCCCGTGGAACTGGGGATGAATGAGGGCAGCGGAACGCGCCGCG
CGCCGCTGCACGGTGTCGCATCCGTACGCACTGAAGGCCAGAACAATGTTGAGTTCGATTTCGACGCGCC
AGAGGTGCAAACCATCGTCGATCTGCGCGTTACCGTTCCATCGCGTTTTCCGGTCAGCGGCGTTCTTCTC
TTCGTGAGGCACCGGTTCTATATGGGTGAAGCTCCAGAGACGAAGGCGGAAGCGCCTCGCGAAGAACTGG
CGACTGCGTTCCGCCCGCCGTTACAGCCAGGAGGCCCGCCGGTCAATAACCGGCCCTCCAGCGTGGCAAG
GAAAGAGGAGCAGTATATCGATGCGCCTATAGCCGGAACTCGTCGGCGCAGGTTGGAAGAATAG