SecReT6
Protein ID: 374310885
SecReT6 ID924
T6SS typeiii
Gene symbol-
Locus tagAciX8_1954
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]2292260..2294365 [+]
Productforkhead-associated protein
NoteFha
UniProt IDG8NSU2
KEGG IDgma:AciX8_1954
PDB IDNA
Domain hit(s) vs Pfam DUF1080 [PF06439], Evalue: 3.30E-26, Aligned region: 32..185
DUF1080 [PF06439], Evalue: 3.30E-26, Aligned region: 191..368
FHA [PF00498], Evalue: 5.70E-15, Aligned region: 628..688
Protein Sequence: 701 a.a.     [Download]
>gi|374310885|ref|YP_005057315.1| forkhead-associated protein [Granulicella mallensis MP5ACTX8]
MRKLKWFSGALLVLASTPALWSAGRDQDPASGWIRLFNGTDRFGWVAPAGNWKITDSALVADGTSASRIY
SDLPFADFILRFDARITGGPADVVVRLDPESKPAQPGIHIGLTDGSLEGQHGNASLTAGAQSWRQFEIRA
EGDQLSATINGMPVAAETDGKSRIGAIQFEVPKGSRLEVRSVWLKPISLNNLYNGTNLDGWRAVNPKEPE
KKSGGVHLPNPFGKSKPPKVAHWSGDGAIRGTGGEGQLETVQTFQDFLLQMSAKVTGSQHGGIALAELLS
RGSAGQYASGYAVDLALSGAEKAVAPGSLLSPEKVRMPGTVADGVHPFTVINRGRRFAMWVDGHEVMDDY
DSRAEGTYHATAGPLSILVGNEHASVELTGVFAATLPQGPQPAPAPTASPAPAPVAAVTPQQTATAATTV
PAFNLPPMPGQSPEDKARAEQVRTLTVQALETQSPEEAVRINKQILTLDPSDMPAQQRLDKAQARLDTQS
EIQEHVLQLRLDSNSKLEQNVERRDALMQQVQDALLHGKTNEARDRLNDAERLGAKGPEVDHLNGIIHQR
IRNRILLWSCLGTAAVLALIAGVMAARRRRQVVVGYLLALDGVEKGRRYLLNQEVTHVGGVAMDTGKKNE
VVVRDPDRLVSRFHLEVHKRKNLYYVIDLDSSNGTYLNGRRLPAGAATRLRSGDRLALANAVSFTLQLSK
S
 
Nucleotide Sequence: 2106 bp     [Download]
>gi|374308961|ref|NC_016631.1|:2292260-2294365 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGCGTAAGCTAAAGTGGTTTTCAGGGGCTCTGCTCGTTCTTGCGTCAACTCCTGCGTTGTGGTCCGCCG
GCAGAGACCAGGATCCAGCATCGGGATGGATCAGGCTCTTTAACGGCACCGACCGATTTGGTTGGGTAGC
GCCTGCGGGCAATTGGAAGATCACCGACTCCGCGCTCGTCGCAGATGGCACGAGCGCGTCGCGAATCTAC
TCCGATCTACCCTTCGCGGACTTCATCTTGCGGTTTGATGCCCGAATCACCGGAGGGCCCGCCGACGTTG
TTGTTCGTCTTGACCCGGAGAGTAAGCCCGCGCAGCCGGGGATTCACATCGGGCTAACGGATGGATCGCT
TGAAGGTCAGCATGGCAATGCTTCGCTGACCGCCGGAGCGCAGAGTTGGCGTCAGTTTGAGATCAGAGCT
GAAGGCGACCAGCTAAGCGCCACCATCAATGGAATGCCCGTCGCTGCAGAGACCGACGGGAAGAGTCGAA
TTGGAGCCATTCAGTTCGAAGTACCGAAAGGGAGCCGGCTCGAAGTGCGCTCGGTGTGGCTCAAGCCCAT
TTCGCTCAATAACCTTTACAACGGTACCAATCTCGACGGATGGCGTGCCGTGAACCCAAAGGAGCCTGAG
AAAAAGAGCGGTGGTGTTCACCTTCCAAATCCCTTTGGTAAATCGAAGCCGCCGAAGGTCGCCCACTGGT
CGGGTGACGGAGCCATTCGCGGCACCGGTGGTGAAGGGCAGCTTGAGACCGTTCAGACATTCCAGGACTT
TCTGCTGCAGATGAGCGCGAAGGTGACAGGCAGCCAGCATGGCGGCATTGCTTTGGCAGAGCTGCTCTCT
CGTGGTTCCGCAGGTCAATACGCCTCTGGCTACGCTGTCGACCTGGCGCTCTCCGGCGCAGAGAAAGCTG
TTGCGCCCGGTAGTCTTCTCTCTCCTGAGAAGGTGAGAATGCCCGGGACGGTCGCTGATGGTGTGCATCC
GTTCACTGTGATCAACCGGGGACGTCGCTTTGCAATGTGGGTCGATGGTCATGAGGTGATGGATGATTAC
GATTCGCGGGCGGAGGGCACGTATCACGCAACAGCGGGGCCGCTCAGCATCCTTGTGGGCAACGAACATG
CCTCCGTCGAGCTGACTGGCGTGTTTGCCGCTACGCTTCCGCAGGGCCCGCAACCGGCTCCCGCCCCAAC
CGCGTCGCCTGCTCCGGCGCCTGTGGCGGCTGTCACTCCGCAACAAACCGCTACCGCGGCAACAACGGTT
CCGGCTTTCAACCTGCCGCCCATGCCCGGACAATCTCCCGAGGACAAGGCACGGGCCGAGCAGGTCCGCA
CCCTTACTGTGCAGGCCCTCGAGACGCAGAGCCCGGAAGAGGCGGTACGCATCAACAAGCAGATCCTGAC
GCTCGATCCGAGTGATATGCCTGCACAGCAACGATTGGATAAAGCCCAGGCCAGACTAGATACGCAGTCG
GAGATTCAGGAGCATGTTCTGCAGTTGCGTCTGGATTCCAATTCGAAGCTTGAGCAGAATGTTGAACGTC
GCGATGCGCTCATGCAGCAGGTGCAGGATGCGCTCCTCCATGGCAAGACCAACGAGGCGCGTGACCGCCT
CAATGATGCCGAGCGATTGGGAGCGAAGGGGCCTGAAGTCGATCATCTGAATGGGATCATTCATCAACGT
ATCCGCAATCGCATCCTGCTTTGGAGCTGCCTCGGCACAGCCGCCGTGCTCGCCTTGATTGCTGGTGTGA
TGGCTGCACGCCGCCGCCGCCAGGTTGTCGTCGGTTATTTGCTGGCGCTCGACGGCGTTGAAAAGGGACG
CCGCTACCTTCTCAATCAGGAAGTGACGCACGTTGGTGGCGTAGCCATGGATACAGGCAAGAAGAACGAG
GTGGTCGTGCGCGACCCGGACCGCCTCGTGTCGCGTTTTCACCTTGAAGTGCATAAGCGGAAAAACCTGT
ATTACGTCATCGACCTGGACAGCTCGAATGGCACGTACCTGAACGGTCGCAGGCTTCCTGCGGGGGCGGC
GACCCGTCTGCGCTCCGGAGATCGGTTGGCGCTCGCCAACGCCGTATCCTTCACGCTGCAGCTCAGTAAA
AGCTGA