SecReT6
Protein ID: 374311769
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2866
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3535190..3535534 [-]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDG8NPT0
KEGG IDgma:AciX8_2866
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.20E-16, Aligned region: 3..21
PAAR_motif [PF05488], Evalue: 1.20E-16, Aligned region: 17..82
Protein Sequence: 114 a.a.     [Download]
>gi|374311769|ref|YP_005058199.1| PAAR repeat-containing protein [Granulicella mallensis MP5ACTX8]
MPPAARATDPHICPGGGGPIVPSGEITVLIDHLPAATVTWQTACTADGDDPIVRGSTGVFINHLPAARVG
DQTTLGGAIMMGSLTCEIGEMGSPPAGAGGFGGVVAGLSVGKGG
 
Nucleotide Sequence: 345 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3535534-3535190 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGCCACCAGCGGCTCGAGCTACAGATCCACACATTTGCCCAGGAGGCGGAGGGCCGATCGTTCCATCCG
GTGAAATTACCGTTCTTATCGATCATCTCCCTGCGGCGACAGTCACCTGGCAGACGGCATGCACTGCTGA
TGGTGATGATCCCATTGTGCGAGGTTCGACGGGGGTGTTCATCAATCATCTGCCGGCCGCACGTGTCGGC
GATCAGACAACCCTCGGAGGCGCGATTATGATGGGCTCTCTTACCTGCGAGATCGGTGAGATGGGGTCGC
CTCCGGCGGGGGCGGGAGGATTCGGTGGGGTTGTAGCCGGTCTTTCCGTGGGAAAGGGGGGGTAG