SecReT6
Protein ID: 374311771
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2868
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3536093..3538126 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDG8NPT2
KEGG IDgma:AciX8_2868
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-64, Aligned region: 30..352
Phage_base_V [PF04717], Evalue: 9.80E-18, Aligned region: 398..486
Phage_base_V [PF04717], Evalue: 9.80E-18, Aligned region: 583..606
Protein Sequence: 677 a.a.     [Download]
>gi|374311771|ref|YP_005058201.1| ImpA family type VI secretion-associated protein [Granulicella mallensis MP5ACTX8]
MPTYTHDRRLLSLTTPLGKDAVLVERFSGHEGISSLTELELELLSFPENPIQPASFIGKRVTLGIAYNLS
GQRYFNGIVRSLKLISHDGQLDESTTPVLVYKAEVVPNLWLLTLNSQTRVFQNKTVIEIVKAVLGVYSIT
PKDDTQATYQPLDYCTQYRETDYDFVARLLEQHGIFFYFIHTQSDHIMVLADNSAQLSPCPVQSTFNYMP
QMDLDGGDFYNMYVHAFDVRTAMVTGKHTLWDYRFTQYARQPSSPASSISKAVTGDNEHEKYDYADAPSA
WAKTDGSDGKIQTVESQLQDIARDRSDTGSVEIFGVSNASLLDSGNTFTLAMHPDEVQNTKYLVLSVEHN
GRQMPPFRTDGTGIGEGYRNTFTAQPASLVYRPARTIPKPRVNGVVTGKVVVPAGEDSYIDKYGRVCVQF
WWDRTRPPNQTDNTLLRVAQAWAGSGWGTYFWPRVNDEVLIDFIEGDPDAPIVVGSLYNGVNKPKYDPAT
EYTRSGILTRSSKNGTAANANELRFEDKKGSEQIFMNAEKDMDHRIEMDHRRYVGGKDSLIVKGSRYDEI
DSDLQSNVKANRVAKVAQNYSLQVGQDHGEKVGNNYSLEAGSEVYIKAATNLVIESGMEICLKAAGGFIT
IGPTGVSISGTMVLINSGGSASSGTAVQISTPEAPDEADDGTKGGKM
 
Nucleotide Sequence: 2034 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3538126-3536093 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGCCAACCTACACACACGATAGACGTCTGCTTTCGCTCACGACTCCACTGGGCAAAGATGCAGTTCTGG
TCGAGAGGTTTTCAGGACACGAGGGAATCTCTTCACTGACGGAGCTGGAGTTGGAACTGCTCAGCTTTCC
TGAGAATCCAATTCAGCCGGCTTCCTTTATCGGCAAGCGCGTTACCCTTGGTATTGCTTATAACTTGAGT
GGGCAGCGTTACTTCAACGGAATCGTGCGTAGCCTGAAGCTGATAAGCCACGATGGGCAGTTGGATGAGA
GTACTACGCCGGTTCTGGTCTATAAGGCTGAAGTCGTACCGAATCTGTGGCTGCTGACACTCAACTCACA
GACGCGTGTCTTTCAGAACAAGACTGTGATCGAGATCGTAAAGGCTGTGCTTGGCGTCTACAGTATTACC
CCCAAGGACGATACCCAGGCCACTTACCAGCCGCTCGACTACTGCACCCAGTACCGTGAGACGGATTACG
ATTTTGTCGCACGTCTTCTGGAGCAGCACGGTATCTTCTTCTATTTCATCCACACCCAGAGCGACCACAT
CATGGTGCTCGCAGATAACTCCGCTCAGCTTTCTCCCTGTCCGGTGCAGAGCACCTTCAACTACATGCCG
CAGATGGATCTGGATGGTGGAGATTTCTACAACATGTATGTGCATGCCTTCGATGTGCGCACTGCGATGG
TCACGGGCAAGCACACGCTCTGGGATTACCGCTTCACACAGTATGCGCGGCAGCCGAGTAGTCCTGCGTC
TTCTATAAGCAAAGCTGTTACCGGAGACAACGAGCACGAGAAGTACGACTACGCTGACGCTCCCTCCGCA
TGGGCGAAGACGGATGGCAGCGATGGCAAGATTCAAACAGTCGAGAGTCAGCTTCAGGACATCGCGCGCG
ATCGCAGCGATACGGGTTCCGTCGAGATCTTCGGTGTTTCGAACGCAAGCCTGCTTGATTCGGGTAATAC
CTTCACGCTGGCGATGCACCCGGACGAGGTGCAGAACACCAAGTACCTGGTGTTGAGTGTCGAGCACAAT
GGCCGGCAGATGCCGCCGTTTCGCACTGACGGCACGGGTATAGGGGAGGGGTATCGTAATACCTTTACCG
CACAACCCGCTTCGCTGGTCTACCGTCCGGCGCGCACCATACCGAAGCCACGTGTCAATGGTGTGGTTAC
GGGTAAAGTTGTTGTCCCGGCAGGTGAAGATTCATACATCGATAAGTACGGCCGTGTCTGCGTGCAGTTC
TGGTGGGATCGCACCAGGCCGCCCAACCAGACAGACAATACGCTTCTTCGTGTTGCACAGGCCTGGGCAG
GCTCCGGGTGGGGCACTTACTTCTGGCCTCGTGTCAACGATGAGGTCTTGATTGATTTCATCGAGGGCGA
TCCCGATGCTCCTATTGTCGTGGGTTCGCTCTATAACGGAGTGAATAAACCAAAATACGATCCGGCGACC
GAATATACGCGCTCAGGTATCTTGACGCGTTCCTCGAAGAATGGCACGGCTGCCAATGCGAACGAGCTTC
GCTTTGAAGATAAAAAGGGGAGCGAGCAGATCTTCATGAATGCGGAGAAAGATATGGACCATCGAATCGA
GATGGACCATCGCAGATACGTCGGCGGAAAGGATTCGCTCATCGTTAAAGGCAGCCGCTATGACGAGATC
GACAGCGATCTGCAAAGTAACGTCAAGGCGAATCGGGTTGCAAAGGTAGCTCAGAACTATTCGCTGCAGG
TCGGGCAGGATCACGGAGAAAAGGTCGGTAATAATTACTCTCTCGAGGCTGGGTCGGAGGTCTATATTAA
GGCGGCCACGAATCTCGTCATCGAGAGCGGCATGGAGATATGCCTCAAGGCCGCGGGAGGCTTTATCACT
ATCGGCCCTACTGGCGTCAGTATCTCCGGGACAATGGTGCTGATCAACAGCGGAGGGAGTGCAAGCTCCG
GAACTGCGGTCCAGATCAGCACTCCGGAAGCTCCTGATGAAGCAGATGACGGAACAAAGGGTGGAAAGAT
GTAG