SecReT6
Protein ID: 374311772
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2869
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3538203..3540905 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDG8NPT3
KEGG IDgma:AciX8_2869
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 612..778
AAA [PF00004], Evalue: 4.10E-17, Aligned region: 228..340
AAA [PF00004], Evalue: 4.10E-17, Aligned region: 618..735
ClpB_D2-small [PF10431], Evalue: 2.70E-15, Aligned region: 787..861
AAA_5 [PF07728], Evalue: 4.60E-14, Aligned region: 228..304
AAA_5 [PF07728], Evalue: 4.60E-14, Aligned region: 617..738
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 62..75
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 206..245
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 266..306
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 366..403
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 461..530
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 610..661
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 682..706
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 781..803
AAA_22 [PF13401], Evalue: 6.10E-07, Aligned region: 227..314
AAA_22 [PF13401], Evalue: 6.10E-07, Aligned region: 421..442
AAA_22 [PF13401], Evalue: 6.10E-07, Aligned region: 616..638
AAA_22 [PF13401], Evalue: 6.10E-07, Aligned region: 678..711
Clp_N [PF02861], Evalue: 6.90E-07, Aligned region: 23..72
Sigma54_activat [PF00158], Evalue: 6.90E-06, Aligned region: 223..244
Sigma54_activat [PF00158], Evalue: 6.90E-06, Aligned region: 617..733
AAA_14 [PF13173], Evalue: 0.00021, Aligned region: 228..359
AAA_14 [PF13173], Evalue: 0.00021, Aligned region: 616..698
AAA_29 [PF13555], Evalue: 0.00026, Aligned region: 220..243
AAA_29 [PF13555], Evalue: 0.00026, Aligned region: 615..642
AAA_19 [PF13245], Evalue: 0.00049, Aligned region: 228..250
AAA_19 [PF13245], Evalue: 0.00049, Aligned region: 615..639
IstB_IS21 [PF01695], Evalue: 0.00064, Aligned region: 220..244
IstB_IS21 [PF01695], Evalue: 0.00064, Aligned region: 617..635
IstB_IS21 [PF01695], Evalue: 0.00064, Aligned region: 728..749
Zeta_toxin [PF06414], Evalue: 0.0012, Aligned region: 228..248
Zeta_toxin [PF06414], Evalue: 0.0012, Aligned region: 611..657
AAA_17 [PF13207], Evalue: 0.0017, Aligned region: 228..242
AAA_17 [PF13207], Evalue: 0.0017, Aligned region: 617..653
NACHT [PF05729], Evalue: 0.0017, Aligned region: 228..255
NACHT [PF05729], Evalue: 0.0017, Aligned region: 617..641
AAA_25 [PF13481], Evalue: 0.0027, Aligned region: 227..297
AAA_25 [PF13481], Evalue: 0.0027, Aligned region: 615..635
Arch_ATPase [PF01637], Evalue: 0.0036, Aligned region: 207..243
Arch_ATPase [PF01637], Evalue: 0.0036, Aligned region: 280..312
Arch_ATPase [PF01637], Evalue: 0.0036, Aligned region: 616..629
Arch_ATPase [PF01637], Evalue: 0.0036, Aligned region: 688..712
AAA_18 [PF13238], Evalue: 0.0049, Aligned region: 228..242
AAA_18 [PF13238], Evalue: 0.0049, Aligned region: 619..646
Protein Sequence: 900 a.a.     [Download]
>gi|374311772|ref|YP_005058202.1| type VI secretion ATPase, ClpV1 family [Granulicella mallensis MP5ACTX8]
MNLKSLIAKLNDTCRSAMEGAAGLCVSRTHYDIEIEHYLLKLLDGTDSDIALILKQYGVDRSRLTRELER
SLDKLKTGNARSPALSPQLLHMFTEAWTLATLDYEAGQIRSGFTLLALLTNSDLSRTVREISSELQLISV
EALRKDFFNIVSSSREETTAIGFGQDVSGPASGTAASGTQRRTPHLDQYTVNMTANAAAGKIDTVLGRDV
EIRQVIDILMRRRQNNPILTGEAGVGKTAVVEGFSLRIAAGDVPPPLRNVQLHSLDLALLQAGASVKGEF
ENRLKGLIEEVKSSPHPIILFIDEAHTMIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKFFEK
DAALARRFQVVKVEEPIEPQCGTMLRGLIPALEKHHGLRILDEAVTAAVRLSHRYMVGRQLPDKAVSVLD
TACARLSLSQSTTPGIIEDAQRRIADLETQTRMLSREEAVGANHVERLREIADALLVEQAKLVTSNTQWQ
QEVALVEKIRALRTELEDANEGDHDKSTAAPSRVALAALERELAEVQGESPMMRVAVDAQIVGEVISAWT
GIPLGKMVKDELATVLELSSHLRNRVIGQDYAMDAIAQRILTSRASLDDPGKPVGVFMLVGPSGVGKTET
ALALSDLLYGGERNLITINMSEFQEAHTVSALKGSPPGYVGYGEGGVLTEAVRRRPYSVVLLDEVEKAHP
DVLELFFQVFDKGSMEDGEGRVINFKNTVLILTSNAATDTMMKLTADPETMPFPEALVNAIKPELNKIFK
PAFLGRMLIVPYLPVRDEALKQIIRLKLGKIVRRLQENHRIVLRYDDALLSEIASRCTEVESGARNVDNI
LSNTMLPEISRELLLRMVQGDAGTAVSVGVGEAGAFTYQWSTGSAVALEDNAPELAAATA
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3540905-3538203 Granulicella mallensis MP5ACTX8 chromosome, complete genome
GTGAACCTGAAATCCCTGATTGCGAAACTCAACGACACCTGCCGCAGCGCGATGGAAGGCGCCGCAGGTC
TGTGTGTCTCGCGCACGCACTACGACATTGAGATCGAACACTATCTGCTCAAGCTGCTTGATGGGACGGA
TAGCGATATCGCTCTCATCTTGAAGCAGTATGGTGTGGACCGGTCACGACTGACCCGCGAACTCGAACGT
TCGCTCGACAAGCTGAAGACGGGAAATGCGCGCTCGCCGGCATTGAGCCCTCAGTTGCTGCACATGTTTA
CCGAAGCCTGGACGCTGGCTACGCTCGATTACGAGGCAGGACAGATTCGCTCGGGATTTACTCTTCTGGC
TCTGTTGACGAACAGTGATCTGTCTCGGACCGTTCGCGAGATCAGCTCTGAATTGCAGTTGATCTCTGTC
GAAGCTCTGCGCAAAGACTTCTTCAATATTGTTAGCTCGTCTCGCGAAGAGACTACCGCTATCGGTTTTG
GGCAGGATGTGTCCGGACCTGCCTCTGGAACGGCTGCGTCCGGTACGCAACGCCGCACGCCTCATCTCGA
CCAGTACACCGTGAACATGACGGCAAACGCCGCAGCGGGAAAGATAGACACCGTACTGGGCCGCGATGTG
GAGATTCGCCAGGTGATCGATATCCTGATGCGTCGCCGCCAGAACAACCCGATTCTGACCGGCGAGGCTG
GTGTAGGAAAGACCGCGGTTGTGGAAGGCTTCTCTTTGCGCATTGCGGCTGGCGATGTGCCGCCGCCGCT
GCGCAACGTTCAGCTTCATTCTTTGGACCTCGCGCTGTTGCAGGCAGGAGCAAGCGTAAAAGGTGAGTTT
GAGAACAGGCTCAAGGGCTTGATTGAGGAAGTAAAGTCCTCACCTCATCCGATCATTCTCTTCATTGATG
AAGCGCATACGATGATCGGCGCCGGTGGCCAGGCCGGGCAGAATGATGCTGCCAATCTGCTGAAGCCTGC
TCTGGCACGTGGAGAGCTTCGCACCATCGCTGCAACCACTTGGTCCGAGTATAAGAAGTTTTTTGAGAAG
GATGCAGCGCTGGCGCGACGTTTTCAGGTCGTCAAGGTTGAGGAGCCGATCGAGCCGCAATGCGGGACGA
TGCTGCGTGGCCTGATCCCAGCGCTTGAGAAGCATCATGGGCTGCGCATCCTGGACGAGGCTGTGACCGC
CGCGGTGCGTTTGTCGCATCGGTATATGGTCGGGCGGCAGTTGCCCGATAAGGCCGTGAGTGTGCTCGAT
ACAGCCTGTGCGCGTCTTTCGCTCAGCCAGAGCACAACCCCTGGCATCATCGAAGATGCGCAGCGCAGGA
TTGCGGATCTCGAGACACAGACGCGTATGCTGAGTCGCGAAGAGGCTGTTGGAGCGAACCACGTGGAGCG
GCTGCGTGAGATTGCCGATGCGCTTCTTGTCGAGCAGGCGAAGCTTGTAACCAGCAATACTCAATGGCAG
CAAGAGGTTGCTCTGGTTGAAAAGATTCGTGCATTGCGGACGGAGTTGGAAGACGCTAACGAAGGCGATC
ATGATAAGAGCACCGCAGCGCCCTCGCGTGTAGCACTTGCAGCGCTCGAGCGTGAGTTGGCCGAGGTTCA
AGGTGAGTCACCTATGATGAGAGTTGCGGTCGATGCGCAGATAGTGGGGGAAGTTATCTCAGCCTGGACC
GGAATTCCACTTGGAAAGATGGTCAAGGATGAACTTGCGACGGTACTGGAACTTTCCTCTCACCTGCGTA
ATCGCGTGATCGGCCAGGACTATGCCATGGACGCGATCGCACAGCGCATACTTACCTCGCGCGCCAGTCT
CGACGATCCAGGAAAGCCTGTCGGCGTGTTCATGCTCGTGGGGCCAAGCGGCGTCGGTAAGACTGAGACT
GCGTTGGCGCTCTCTGACCTGTTGTATGGCGGCGAACGCAACCTCATTACGATCAATATGTCGGAGTTCC
AGGAAGCGCATACTGTTTCCGCACTCAAGGGTTCGCCTCCGGGATATGTGGGGTACGGCGAGGGCGGTGT
GTTGACCGAAGCTGTGCGCCGCCGGCCGTACTCTGTCGTCCTGCTCGACGAGGTAGAGAAGGCGCATCCC
GATGTGCTGGAGCTCTTCTTCCAGGTCTTCGACAAGGGAAGCATGGAGGACGGAGAGGGGCGCGTCATCA
ACTTCAAGAATACGGTGTTGATTCTCACCAGCAATGCCGCTACCGATACCATGATGAAGCTGACGGCAGA
TCCTGAGACGATGCCTTTCCCAGAGGCGCTGGTGAATGCGATCAAGCCGGAGCTGAACAAGATCTTCAAG
CCCGCGTTTCTCGGACGCATGTTGATCGTTCCCTACCTGCCGGTTCGGGATGAGGCTCTCAAGCAGATCA
TCCGCCTTAAACTCGGAAAGATTGTCCGTCGCCTGCAGGAGAATCACAGGATCGTTTTGCGCTACGATGA
CGCTTTGCTGAGCGAGATCGCAAGCCGCTGCACTGAGGTCGAAAGTGGAGCACGCAACGTAGATAACATC
CTGTCGAATACCATGCTCCCCGAGATCTCGCGTGAGCTGTTATTGCGCATGGTGCAGGGAGATGCAGGTA
CTGCCGTCTCGGTAGGCGTGGGGGAGGCTGGGGCATTCACCTATCAATGGAGCACGGGGAGCGCTGTTGC
CTTAGAGGACAACGCTCCTGAGCTTGCCGCTGCAACTGCTTAG