SecReT6
Protein ID: 374311773
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2870
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3540950..3542023 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDG8NPT4
KEGG IDgma:AciX8_2870
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-93, Aligned region: 29..341
Protein Sequence: 357 a.a.     [Download]
>gi|374311773|ref|YP_005058203.1| type VI secretion protein [Granulicella mallensis MP5ACTX8]
MDATSRQSSAAIEVESTREHEALFHMLSEEPFSFRFFQSVRLLERLFPERKPVGYFVSPQSEVVRFSSRT
SLNFPASEIQSFRENDSRPNDMEVNFLGLTTVNGPLPHPYAEHLLDRMRAKDYAPGDFFNLFNHRFVSLF
YRSWKRYRFFIGYELDKTRGQVSGDPVTASLYSLLGFGTAGLLQRTAVPDEAMLYYAGLLGRNVPTSQAL
KQLLSDFFEVPVRIEEFTGNWNLLPEEDLTYLNDTGLQSESLGIGTIVGDAVWDQHGTVTVRLGPMPLKQ
YQDFLPGGVAARQLEAWLRLFGQGEFDFAVRLVLAREEVPGVLLTPEQNGMGRLGFESWLKNRPFLHDAE
DAVYRLH
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3542023-3540950 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGGATGCCACGAGCAGGCAGTCGAGTGCTGCTATAGAAGTTGAAAGTACCCGCGAGCATGAAGCGCTAT
TCCATATGCTGAGTGAAGAACCCTTTTCCTTCCGCTTCTTTCAGTCCGTGCGCCTGTTGGAGAGATTGTT
TCCCGAGCGGAAGCCGGTAGGCTATTTCGTCTCTCCTCAGAGCGAAGTCGTGCGTTTCTCCTCGCGCACG
TCACTTAACTTTCCTGCGAGCGAAATACAAAGCTTTCGTGAAAATGACTCGCGACCCAATGACATGGAGG
TCAACTTCCTCGGCCTGACTACCGTCAACGGGCCGCTGCCGCATCCCTATGCAGAGCATCTGTTGGACCG
TATGCGCGCGAAGGATTATGCCCCGGGTGATTTCTTCAACCTCTTCAATCACCGCTTTGTCTCTCTTTTC
TATCGTAGTTGGAAGAGATATCGCTTCTTTATTGGTTACGAACTGGATAAGACGCGTGGGCAGGTTAGTG
GAGACCCGGTCACGGCTAGTCTCTATAGCTTGCTTGGATTCGGCACTGCTGGTTTGTTGCAACGCACTGC
CGTGCCCGATGAGGCCATGCTTTACTACGCAGGTCTGCTGGGACGCAATGTGCCGACTTCGCAGGCGCTG
AAGCAGCTGCTCAGCGACTTCTTTGAAGTGCCGGTACGAATCGAAGAGTTTACCGGAAACTGGAACCTTT
TGCCGGAAGAGGATCTTACCTATCTGAACGATACCGGGCTGCAATCAGAGTCCCTGGGCATCGGCACGAT
TGTGGGCGATGCGGTATGGGACCAGCACGGCACAGTGACGGTACGTCTAGGGCCTATGCCGCTGAAGCAG
TACCAAGACTTTCTTCCCGGAGGTGTTGCGGCCAGGCAACTGGAAGCCTGGTTGCGGCTCTTCGGACAGG
GAGAGTTCGACTTTGCGGTGCGACTGGTGCTTGCACGCGAAGAGGTGCCGGGAGTGTTGCTAACGCCGGA
ACAAAACGGAATGGGCAGGCTCGGCTTTGAAAGCTGGTTGAAGAATCGTCCGTTTCTGCACGATGCAGAG
GACGCTGTGTACCGCCTGCACTAG