SecReT6
Protein ID: 374311774
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2871
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3541987..3543831 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDG8NPT5
KEGG IDgma:AciX8_2871
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.80E-195, Aligned region: 5..614
Protein Sequence: 614 a.a.     [Download]
>gi|374311774|ref|YP_005058204.1| type VI secretion protein [Granulicella mallensis MP5ACTX8]
MRPELLDSYERELAYLRDMGAEFGRKYPRVASRLLLEPDRCEDPHVERLIESFAFMAARLHLRLDDDLPE
LTSSLLNLIYPHYLRPIPAMTVVECQIEAESAGKQSSSLMMPEGTMLNTRRNVDGMTCRFRTTYPVELWP
ITVAECSWRMPEQLPRPVRIAGAAAALRMVLRGGKDVKPGALGISSLRFYISGDSNVVFTLYELLASKCI
SILLRDPRAPEGRTITIPPSSLRPVGFEEEESLLPYPRRSFDGYRLLQEYFAFPQKFLFFDLSGLEAMSA
FAASDEVELLFHFSRFERPERQQVLEVGVSNETLRLGCTPAINLFSQAAEPILLTQTQHEYRVTADARYT
RMMEVFSIDDVLATSPSKRQTTPLAPLYAYRYNTIAQEQGVFWHANRRYSSFEERQPSSVFLSLVDLNGS
LTEPGAEVLTVHCTCSNHDLPSQLSFGAAEGDFEAVNFAGVQRIRALHRPTSSLDPPAGKGQLWRLISQL
SLNYLSLGEGGLGALQEILRIHNFSESSQVESQIAGLIAMRNKRHFAIMRADYGNTPARGTRVEIELDER
QFANGGAYLFASVLERFLGSYVSMNSFCQLRAESNLRKEGLGTWMPRAGSRVLL
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3543831-3541987 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGCGACCTGAGTTACTAGATTCTTATGAACGCGAGCTAGCCTATCTCCGTGATATGGGGGCGGAGTTTG
GCCGCAAGTACCCACGCGTGGCCAGCCGGCTGCTGCTCGAACCGGATCGCTGCGAAGACCCTCATGTCGA
GCGGTTGATCGAGTCATTCGCCTTTATGGCGGCCCGGCTTCATCTGCGCCTGGATGACGATCTGCCGGAG
CTGACCTCCTCTCTCCTCAACCTTATTTATCCGCATTACCTGCGGCCCATTCCGGCGATGACCGTTGTGG
AATGTCAGATCGAGGCTGAGAGTGCTGGCAAACAAAGTTCCTCTCTGATGATGCCTGAGGGGACGATGCT
CAATACGCGAAGAAACGTGGATGGTATGACGTGCCGCTTTCGCACCACCTACCCGGTCGAACTGTGGCCA
ATCACCGTGGCGGAATGTTCCTGGCGTATGCCCGAACAGTTGCCGCGTCCGGTAAGGATTGCAGGTGCTG
CAGCGGCTTTACGTATGGTGCTGCGCGGTGGCAAGGATGTTAAGCCTGGGGCACTCGGTATCTCTTCATT
GCGCTTCTATATCTCTGGTGACAGCAACGTCGTCTTCACGCTGTATGAGTTGTTGGCGAGTAAGTGCATC
TCCATTCTGCTAAGAGACCCTCGTGCCCCTGAGGGAAGAACGATCACTATCCCGCCGTCGTCGCTCAGGC
CTGTGGGCTTTGAAGAAGAGGAGAGCCTGCTGCCTTATCCGAGGCGCTCGTTCGACGGCTACCGGCTCCT
GCAGGAGTACTTTGCCTTTCCGCAGAAGTTTCTCTTCTTCGACCTCTCGGGATTGGAAGCTATGTCAGCG
TTCGCAGCGAGTGATGAGGTTGAACTGCTGTTTCACTTCAGCCGATTCGAGAGGCCGGAACGTCAGCAAG
TTCTCGAGGTCGGTGTCTCAAATGAAACTCTGCGGCTTGGCTGCACTCCGGCTATTAATTTGTTTTCTCA
GGCGGCCGAACCGATACTCCTGACGCAGACGCAACATGAGTACCGCGTGACGGCCGATGCGCGTTATACC
CGCATGATGGAAGTCTTTTCAATCGACGACGTGCTCGCAACCAGCCCGAGCAAACGGCAAACTACACCTC
TCGCACCCCTCTATGCCTATCGTTACAACACGATCGCGCAGGAGCAGGGAGTGTTCTGGCATGCCAATCG
CCGGTATTCATCTTTTGAAGAGAGACAGCCTTCGTCCGTGTTTCTGTCGCTGGTCGATCTGAACGGTTCA
CTCACCGAGCCGGGCGCGGAAGTGCTGACGGTTCACTGCACCTGTTCTAACCATGACCTGCCATCGCAAC
TGAGTTTCGGAGCCGCGGAGGGTGACTTCGAGGCAGTGAATTTTGCGGGTGTACAGCGCATTCGAGCATT
ACACCGACCCACGTCTTCGCTCGATCCGCCTGCCGGCAAGGGCCAGCTGTGGCGACTCATCTCGCAGCTA
TCGCTCAATTACCTTTCGCTCGGCGAAGGCGGTCTGGGGGCTTTGCAGGAGATTCTGCGCATTCATAACT
TCTCTGAATCCTCGCAGGTGGAGTCGCAGATTGCCGGACTGATTGCCATGCGAAATAAACGGCACTTCGC
CATCATGCGTGCCGATTACGGCAATACTCCGGCACGAGGGACGCGCGTCGAAATAGAACTCGACGAGCGG
CAGTTTGCTAATGGCGGAGCTTATCTCTTTGCGAGTGTGCTGGAGAGATTTCTCGGCTCCTATGTGTCGA
TGAACAGTTTTTGCCAGTTGCGAGCAGAAAGCAATCTACGAAAGGAGGGACTGGGAACATGGATGCCACG
AGCAGGCAGTCGAGTGCTGCTATAG