SecReT6
Protein ID: 374311775
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2872
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3543836..3544297 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDG8NPT6
KEGG IDgma:AciX8_2872
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-18, Aligned region: 34..136
Protein Sequence: 153 a.a.     [Download]
>gi|374311775|ref|YP_005058205.1| type VI secretion system lysozyme-like protein [Granulicella mallensis MP5ACTX8]
MARAPELLVTQSVLDRLSTTEDWPTTRAQSIRFLRDSIKRNLEWLLNTRRPPIEGIEGYPLARNTVLYYG
LLDLGSLSLASTDDQKRLQQRIAEMVEHSEPRLQEVQVRLEDGDLQKKKLRFHIGARMQMKPLPEEIAFD
TVLDLATGEYQVD
 
Nucleotide Sequence: 462 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3544297-3543836 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGGCACGAGCGCCTGAGTTATTGGTAACGCAATCTGTACTTGACCGGTTGAGCACGACTGAAGACTGGC
CAACGACCCGCGCGCAATCCATTCGATTTTTACGTGACAGCATCAAACGCAATCTTGAATGGCTGCTGAA
TACGCGTCGCCCTCCTATCGAAGGTATTGAAGGCTATCCTCTTGCTCGTAATACGGTTCTTTATTACGGG
TTGTTGGATCTTGGCTCGCTTAGTCTCGCTTCAACCGATGATCAGAAGCGCCTGCAGCAGAGAATCGCCG
AGATGGTGGAGCACTCTGAGCCACGTTTGCAAGAAGTGCAGGTGCGCCTTGAAGACGGAGACCTGCAGAA
AAAGAAGCTGCGCTTCCACATTGGCGCTCGCATGCAGATGAAGCCTTTGCCGGAGGAGATCGCCTTCGAC
ACCGTACTGGATCTCGCTACTGGCGAATATCAGGTGGATTGA