SecReT6
Protein ID: 374311776
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2873
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3544312..3546210 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDG8NPT7
KEGG IDgma:AciX8_2873
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-16, Aligned region: 54..113
Protein Sequence: 632 a.a.     [Download]
>gi|374311776|ref|YP_005058206.1| type VI secretion-associated protein, ImpA family [Granulicella mallensis MP5ACTX8]
MPLRDDLLTPIAGDNPAGASLRYDRVYDQIKEARTEDDDSLPTGAWERQSKRADFKVVAKLAGEALANRS
KDLHLAVWLGEALLKQEGISPLTSILQLCLDLQQNFWETLYPEIDEGDPGLRVVPLQWAANRYAALVYGA
GLTLEPINFFEYKAARVVGREEDANNSEQQREVRAKAIADGKLTSEEVDEAIAATPKAFYVALDGSLVSA
IEVLRELDVYCEESYGQEAPSFRKLREALEEVQNLVGSLLRDKRRLEPDPAEDTSGGEIEREIYASDGEA
SSALTASLDEGNDQSAQAPTHSASKQPLRSEKRQTSACESWDDALGHIESAVTYMGGQDPSSPLPFLLRS
SMRLAELRGISVSRQMEYLIAPSSELRQALKGVAGSGDWLELHRQSFEALGTPCGRGWLDLYRYLWTSCR
AMGWEAQQLSIAVAMQQILRELPELREWTLNDDTPVANAETMRWLAEEIAPPIAHGNHEEEHSAAAPVAI
AMPVVALVSEGESSGAAEAEDLFHTAQELAARGQVQGAIQMLARDAEHQSIGRLRYSRNLQIAELCLQSG
NSAVAVPMLQELIREVEDRKLESWEPRGIVAKPYVLLLQCASAVTLDAAPLFARLCAIDPSVALAITPPA
QS
 
Nucleotide Sequence: 1899 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3546210-3544312 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGCCACTGCGTGACGATCTACTGACACCTATTGCCGGGGATAATCCAGCAGGCGCAAGCCTCCGCTATG
ACCGGGTCTATGACCAGATCAAAGAGGCTCGTACGGAGGATGACGACTCTCTTCCGACGGGTGCCTGGGA
GCGGCAGAGCAAACGTGCTGACTTTAAGGTTGTTGCGAAGTTAGCCGGCGAGGCGTTGGCAAATCGGAGT
AAGGACCTGCACCTTGCTGTCTGGCTGGGAGAAGCTCTCCTCAAGCAGGAGGGCATCTCTCCGCTGACAT
CTATATTGCAGCTTTGTCTTGATTTACAGCAGAACTTTTGGGAGACGTTATACCCGGAGATTGATGAAGG
CGATCCGGGCCTGCGCGTTGTCCCTTTGCAGTGGGCCGCAAATCGCTATGCTGCGCTTGTCTATGGTGCC
GGGCTTACATTGGAGCCCATTAATTTTTTCGAGTATAAAGCCGCACGTGTTGTCGGCAGGGAAGAAGACG
CGAACAATAGCGAGCAGCAGCGGGAAGTCCGCGCCAAAGCGATCGCTGATGGAAAGCTCACAAGTGAAGA
GGTAGATGAAGCGATTGCCGCTACGCCGAAGGCGTTCTATGTGGCTCTCGATGGATCGTTGGTCTCCGCT
ATCGAAGTGCTGCGTGAACTGGATGTCTATTGCGAGGAGAGCTATGGGCAGGAGGCTCCTTCGTTTCGCA
AACTGCGGGAGGCTCTCGAAGAGGTACAAAATCTCGTCGGCTCCTTGCTGCGTGACAAGCGTCGGCTGGA
ACCCGACCCGGCGGAAGATACATCGGGTGGAGAGATCGAACGCGAAATCTATGCTTCTGATGGTGAAGCT
TCCAGCGCGTTGACGGCCTCCCTAGACGAAGGAAACGATCAGTCTGCGCAGGCTCCCACCCACTCCGCTT
CGAAACAGCCACTACGCTCCGAAAAAAGGCAGACATCGGCATGCGAAAGTTGGGACGACGCTCTTGGTCA
TATCGAGTCTGCAGTGACTTATATGGGTGGCCAGGATCCGAGCAGCCCTCTGCCATTTCTGCTACGAAGC
TCGATGCGTCTCGCTGAGTTGCGTGGGATTTCCGTAAGTCGGCAGATGGAATACCTGATAGCTCCCTCTT
CGGAGTTGAGGCAGGCCCTTAAAGGAGTAGCTGGTTCTGGGGACTGGCTGGAACTGCATCGCCAGAGCTT
TGAAGCGCTTGGAACTCCCTGTGGCCGCGGATGGCTTGATCTTTATCGTTACCTCTGGACAAGTTGCAGA
GCCATGGGTTGGGAGGCGCAACAGCTTTCCATCGCCGTCGCGATGCAGCAGATACTGCGTGAATTGCCAG
AGCTGCGGGAATGGACGTTGAATGACGATACACCGGTTGCAAATGCAGAGACGATGCGTTGGCTTGCAGA
AGAGATTGCTCCTCCTATAGCTCACGGCAATCATGAGGAGGAGCATTCGGCAGCAGCTCCTGTTGCGATA
GCCATGCCTGTGGTCGCACTGGTATCTGAAGGCGAGTCCTCCGGCGCGGCAGAGGCAGAAGACCTCTTCC
ATACGGCTCAGGAGCTTGCTGCCAGGGGGCAGGTTCAGGGTGCTATTCAGATGTTAGCGCGCGATGCGGA
GCATCAATCGATTGGGCGTCTGCGATACAGCCGCAACCTGCAGATCGCAGAGCTGTGTCTGCAGAGCGGC
AATAGTGCTGTTGCAGTGCCGATGTTGCAGGAGCTTATACGCGAAGTGGAAGACCGCAAGCTTGAAAGCT
GGGAGCCACGCGGGATCGTCGCAAAGCCTTATGTGCTGCTGCTGCAGTGTGCTTCCGCGGTGACGCTCGA
CGCTGCCCCACTCTTTGCGCGGCTGTGCGCCATCGATCCGAGCGTTGCGCTTGCCATTACCCCACCCGCA
CAGAGCTAA