SecReT6
Protein ID: 374311777
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2874
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3546210..3546941 [-]
Productvirulence protein SciE type
NoteTagJ
UniProt IDG8NPT8
KEGG IDgma:AciX8_2874
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 5.80E-28, Aligned region: 104..232
Protein Sequence: 243 a.a.     [Download]
>gi|374311777|ref|YP_005058207.1| virulence protein SciE type [Granulicella mallensis MP5ACTX8]
MDALSLYKAGQLGPAIETLGVELRTQPGDTRLRTFLFELLCFAGAYDRAEKQLDILADANQDAFAGALLY
RAALHAQRTREELLLSGQLPARDSDSGPVSGSLNGTAFSSFEDEDSRFGTHLEAFIAGSYTLIPFRYIQR
VEIAPPKRLRDLLWATAILTTTPDFRLQDLGEVLLPVLSPGSSTFPDDLVRLGRTTVWQNTGNEEDELPL
GQKSFLVDGEAHSLLSVRELTFTRNSSLTAEER
 
Nucleotide Sequence: 732 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3546941-3546210 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGGATGCACTTTCACTTTACAAGGCCGGGCAATTGGGCCCGGCCATTGAGACCCTTGGTGTTGAGCTTC
GTACGCAGCCTGGTGACACCAGGCTGCGCACTTTTCTCTTCGAACTACTTTGCTTCGCGGGTGCTTATGA
TCGTGCGGAGAAACAACTCGATATTCTTGCTGATGCAAATCAGGATGCCTTTGCCGGCGCGCTGTTGTAC
CGTGCTGCGCTACATGCACAACGCACTCGGGAAGAACTCCTGCTTAGTGGGCAGCTTCCAGCCAGAGATT
CTGATTCTGGTCCGGTCTCAGGTTCGTTGAACGGGACGGCCTTTAGCTCTTTTGAGGATGAGGACTCGCG
GTTTGGAACTCACCTTGAGGCCTTTATCGCTGGCAGCTATACCCTCATTCCTTTTCGATATATCCAGCGG
GTAGAGATCGCGCCGCCTAAGCGCCTGCGGGATCTGCTCTGGGCTACGGCTATCCTCACGACAACTCCAG
ATTTTCGTTTGCAGGATCTTGGAGAAGTCCTGCTTCCCGTGCTCTCTCCGGGCAGCTCAACCTTTCCTGA
TGATCTGGTGCGTCTGGGGCGCACAACGGTATGGCAGAACACAGGCAACGAAGAGGACGAGCTTCCTCTG
GGGCAGAAGAGCTTTCTTGTCGATGGTGAAGCCCACTCCTTACTCTCCGTGCGCGAGCTCACTTTTACCC
GTAATTCATCGCTTACGGCAGAGGAAAGATAA