SecReT6
Protein ID: 374311778
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2875
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3546955..3547446 [-]
Producthypothetical protein
NoteTssD
UniProt IDG8NPT9
KEGG IDgma:AciX8_2875
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.80E-23, Aligned region: 10..138
Protein Sequence: 163 a.a.     [Download]
>gi|374311778|ref|YP_005058208.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MPYAGELDYYLNIPGCQGESQTSGATNQIKVNSFSFGGNSVSSVDATSGSSSGKVICGDLNLDLVMDKGG
PLLFQGMTKGTHFATATLTGLKTAGSSPGTYFTLALTEAYVSSTQFSGQSSMPNLGISLSYNQITITYYM
QSATGTLTSTGSVSYSRTTQVSS
 
Nucleotide Sequence: 492 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3547446-3546955 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGCCATATGCAGGCGAACTTGATTACTACCTCAATATTCCAGGTTGCCAGGGTGAGTCCCAGACCTCGG
GTGCTACCAACCAGATCAAGGTGAATAGTTTCAGCTTCGGCGGCAACTCCGTGAGCAGCGTGGATGCAAC
CTCGGGTTCGTCGTCGGGGAAGGTAATCTGCGGCGATCTCAATCTCGATCTGGTGATGGATAAGGGCGGC
CCACTGCTTTTTCAGGGAATGACAAAGGGTACCCACTTCGCTACGGCTACGCTGACCGGATTGAAGACGG
CCGGCTCTTCTCCTGGAACTTACTTTACTCTCGCGTTGACAGAGGCTTATGTGTCCAGCACGCAGTTCAG
TGGCCAGTCTTCCATGCCCAATTTGGGCATCTCCCTGTCCTATAACCAAATCACCATCACGTACTACATG
CAGTCGGCGACAGGCACTCTCACCTCGACGGGTTCTGTTTCTTATTCGCGTACGACACAGGTAAGCAGCT
AG