SecReT6
Protein ID: 374311779
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2876
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3547508..3549010 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDG8NPU0
KEGG IDgma:AciX8_2876
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-192, Aligned region: 72..495
Protein Sequence: 500 a.a.     [Download]
>gi|374311779|ref|YP_005058209.1| type VI secretion protein EvpB [Granulicella mallensis MP5ACTX8]
MSTTKTSVAAATSTVAANGEAQDVSLLDQIVAEGRFSKDAASQERGRDMIKEFVAQVLEGHMTVSRDAEA
TIQTRIAQIDQLISLQLNEILHHPSFQKLEGTWRGIRYLMDQSETNSMLKIKVLNVSKRELLKDLQRASE
FDQSSLFKKVYEEEFGVFGGAPFAALIGDYEFGRGPEDIELLERVAQVASAAHAPFLSAASANLLNLEDF
TQLGSPRDIGKIFDTTEYAKWKSFRQSEDSRYVGLTLPHVLMRLPYGKETKAVDDFDYEEAVDGTDHSKY
LWGNAAYALGARLTNAFARYGWCAAIRGVEGGGLVEGLPAHTFRTDEGDVALKCPTEIAVTDRREKELAD
QGFIPLVHCKGTDYAAFFSVQSGNKPKLYDKDAANANARLSAQLPYILAMSRFAHYLKAIMRDKLGSFMS
RDECEIFLNQWISHYVLSNDVATHAAKAKLPLREASIQVSEVPGKPGAYRAVAFLKPHFQLDELTISLRL
VADLPESARS
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3549010-3547508 Granulicella mallensis MP5ACTX8 chromosome, complete genome
TTGAGCACAACCAAGACATCAGTTGCAGCAGCGACCTCTACGGTCGCTGCGAACGGCGAAGCACAGGACG
TATCTCTTCTTGATCAGATTGTTGCCGAAGGACGCTTCAGCAAGGATGCTGCGAGCCAGGAACGTGGCCG
CGACATGATCAAGGAATTTGTGGCCCAGGTACTCGAAGGCCACATGACCGTGAGCCGGGATGCTGAAGCT
ACTATTCAGACGCGCATTGCGCAGATCGACCAGTTGATCTCGCTGCAGTTGAATGAAATTCTTCACCACC
CGTCTTTTCAGAAGCTTGAAGGAACGTGGCGCGGGATCCGGTACCTCATGGACCAGAGCGAAACCAACTC
CATGCTGAAGATCAAGGTTCTCAATGTTTCCAAGCGGGAGCTGCTCAAGGATCTGCAGAGAGCTTCGGAG
TTCGATCAAAGCTCCCTGTTCAAGAAGGTCTATGAAGAAGAGTTCGGAGTCTTCGGTGGTGCACCTTTTG
CTGCACTGATCGGTGACTACGAGTTCGGACGTGGACCCGAAGATATCGAGCTGCTGGAACGAGTGGCGCA
GGTGGCCTCAGCCGCTCATGCTCCGTTCCTTTCTGCTGCCTCGGCTAATCTGCTTAACCTCGAGGACTTT
ACCCAGCTTGGAAGCCCGCGCGACATCGGAAAGATCTTCGATACGACCGAGTATGCCAAGTGGAAGAGCT
TCCGCCAGTCTGAGGACTCGCGCTATGTAGGGTTGACGCTGCCTCACGTTCTGATGCGTCTGCCCTATGG
AAAAGAGACGAAAGCTGTCGACGACTTCGACTACGAAGAAGCAGTCGATGGTACGGATCACTCCAAGTAT
CTGTGGGGCAATGCAGCCTATGCTTTGGGTGCGCGTCTCACAAACGCATTCGCAAGGTATGGCTGGTGCG
CTGCGATCCGCGGTGTTGAGGGTGGCGGCCTTGTGGAAGGACTTCCGGCACACACCTTCCGTACCGATGA
GGGTGATGTCGCACTCAAGTGCCCCACGGAGATTGCGGTTACAGACCGTCGCGAAAAAGAACTCGCCGAT
CAGGGCTTTATCCCGTTGGTGCACTGCAAGGGCACAGACTACGCGGCCTTTTTCAGTGTTCAGTCCGGCA
ACAAGCCGAAGCTCTACGACAAAGATGCGGCGAATGCGAATGCTCGGCTCTCCGCTCAGCTCCCATACAT
TCTCGCGATGTCGAGATTTGCGCACTATCTTAAAGCGATTATGCGCGATAAGCTTGGCAGCTTCATGTCG
CGTGACGAATGCGAGATATTCCTGAACCAATGGATTTCGCATTATGTCTTGTCGAACGATGTTGCGACCC
ACGCTGCCAAAGCGAAGTTGCCACTCCGTGAAGCTTCGATTCAGGTGTCAGAGGTTCCCGGCAAGCCTGG
TGCCTACCGTGCGGTTGCTTTCCTCAAGCCGCACTTCCAGTTGGATGAACTCACCATCTCCCTCCGCCTT
GTTGCGGATCTTCCTGAGTCTGCGCGCAGCTAA