SecReT6
Protein ID: 374311780
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2877
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3549007..3549522 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDG8NPU1
KEGG IDgma:AciX8_2877
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-56, Aligned region: 10..166
Protein Sequence: 171 a.a.     [Download]
>gi|374311780|ref|YP_005058210.1| type VI secretion protein [Granulicella mallensis MP5ACTX8]
MARESTQHKLDRVRSPRVQITYDVEVGDAIELKELPFVMGVLGDLTGQPKTPLEALKERKFVEINPDNFD
TVLKGMEPHLAYSVANKLSDMGDGAQIKVDLTFESLEDFEPVNVARQVGPLRELLELRTRLSDLRGTLQG
NDKLDEMLLAAVSNTETRDKLRKEVTSGGAN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|374308961|ref|NC_016631.1|:c3549522-3549007 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGGCAAGAGAAAGTACACAGCATAAGCTTGATCGCGTACGTTCGCCGCGCGTTCAGATTACCTACGACG
TCGAGGTGGGTGATGCGATCGAATTGAAGGAGCTGCCGTTCGTGATGGGTGTGCTCGGAGACCTGACCGG
TCAGCCGAAGACCCCGCTCGAGGCTCTCAAGGAACGCAAGTTTGTCGAGATCAACCCCGACAACTTCGAT
ACCGTGCTCAAGGGTATGGAGCCGCACCTGGCCTATTCTGTCGCCAATAAGCTGAGCGATATGGGTGACG
GAGCGCAGATCAAAGTCGATCTGACCTTCGAGTCGCTCGAAGATTTTGAGCCGGTAAATGTTGCGCGGCA
GGTTGGACCGCTGCGCGAGCTGCTCGAGCTGCGCACGCGTCTCTCGGATCTTCGCGGCACCCTCCAGGGC
AACGACAAGCTGGATGAGATGCTGCTGGCTGCGGTCTCCAATACGGAAACGCGCGACAAGCTGCGTAAAG
AAGTCACCAGTGGAGGTGCGAATTGA