SecReT6
Protein ID: 374311782
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2879
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3550020..3551369 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDG8NPU3
KEGG IDgma:AciX8_2879
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-120, Aligned region: 19..446
Protein Sequence: 449 a.a.     [Download]
>gi|374311782|ref|YP_005058212.1| type VI secretion protein [Granulicella mallensis MP5ACTX8]
MSKMLPVVWTKGVFLSPQHLQAQDRFFQDLLSFRVDSLTFRSWGFMELAIDGGSVAGGSLEITFCSGLFP
DHLAFDTNHGSPLPRARSLEECFPEGRQRCAFFLAIPQHREGGLNIGSERGGLSTRFFSELQLLRDETGQ
TASERPVALARNNLAILAEGETMEGSVLLPLALVERTEAGLYQLSSTFVPPLLDVHASSYLLGILRGLVE
LLVARSSQLAGVRRQRNESLADFSASDIANFWLLYTLNTELPGLRHLLGATRVHPETLFTAMLRLAGSLT
TFSTTVEARDLPRYDHENLGACFSVLDALLRELLDTVVPSNFIALPLKLVHPTVYAAVIDKDEYLRSARF
YLAVSSTIRRGELISRFPMLSKVGSGTQIEDLIRQALPGLRLVHVPVPPRAIPVRLDYQYFSIEASGLMW
ESVTRARNIAVYAPGELGDPQMELIILPQ
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|374308961|ref|NC_016631.1|:3550020-3551369 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGTCTAAAATGCTTCCTGTTGTGTGGACAAAGGGCGTATTTCTATCTCCACAGCACCTTCAGGCACAAG
ATCGGTTTTTCCAGGACCTGCTGAGTTTTCGCGTCGACTCGCTCACATTCCGCAGTTGGGGTTTCATGGA
GCTTGCCATCGACGGTGGCAGCGTAGCAGGTGGCAGCCTCGAGATTACCTTCTGCAGTGGTCTCTTCCCC
GACCATCTCGCCTTCGACACAAATCACGGCAGTCCTTTGCCACGCGCCCGTTCTCTCGAAGAGTGTTTTC
CAGAAGGCCGGCAGCGGTGCGCCTTCTTTCTGGCCATTCCGCAACATCGCGAAGGCGGTCTGAACATTGG
ATCGGAACGCGGAGGGCTGAGCACTCGCTTCTTTTCTGAGTTGCAACTGCTTCGTGACGAGACCGGACAG
ACGGCCAGCGAACGTCCCGTGGCGCTGGCTCGCAACAACCTCGCCATCCTTGCTGAAGGCGAGACGATGG
AAGGCTCGGTACTTCTGCCGCTCGCGCTTGTAGAGCGGACGGAAGCGGGTCTCTATCAACTGAGCTCTAC
GTTCGTTCCGCCTCTGCTCGATGTCCACGCCAGCAGCTATCTGCTCGGCATTCTGCGCGGCCTGGTGGAG
TTACTCGTCGCACGCAGCAGCCAACTTGCAGGGGTGCGCCGGCAACGCAATGAAAGTCTTGCCGACTTTA
GCGCATCGGATATCGCAAACTTTTGGCTTTTGTACACCCTCAACACGGAGTTGCCTGGCCTGCGGCATCT
GTTGGGCGCAACCAGGGTGCATCCTGAGACGCTGTTTACAGCGATGCTGCGACTCGCCGGATCTCTTACG
ACCTTTTCAACCACAGTAGAAGCACGCGATCTCCCGCGCTACGATCATGAGAATCTCGGAGCTTGCTTCT
CGGTGCTCGATGCCTTGCTGCGTGAGTTGCTCGACACGGTTGTTCCCAGCAACTTCATCGCACTGCCACT
GAAGCTGGTGCATCCAACGGTGTACGCGGCCGTGATCGACAAGGATGAATATCTTCGTTCTGCGCGGTTC
TATCTCGCCGTATCTTCCACAATAAGGCGGGGAGAACTGATCTCACGCTTCCCTATGCTCTCAAAGGTAG
GCTCAGGCACCCAGATTGAGGACCTGATTCGGCAGGCGCTTCCTGGTCTTCGGCTCGTCCATGTGCCTGT
TCCACCCCGCGCCATTCCTGTACGCCTCGATTACCAGTATTTCTCCATCGAAGCGAGCGGACTGATGTGG
GAATCGGTTACACGTGCACGCAACATTGCCGTGTATGCTCCAGGCGAACTTGGCGATCCCCAGATGGAGT
TGATCATACTGCCGCAGTAA

Protein ID: 374311784
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2881
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3552987..3554360 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDG8NPU5
KEGG IDgma:AciX8_2881
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-104, Aligned region: 19..452
Protein Sequence: 457 a.a.     [Download]
>gi|374311784|ref|YP_005058214.1| type VI secretion protein [Granulicella mallensis MP5ACTX8]
MKSLSRVVWTEGMYMSPQHFQAQSRFYEDTVDFVTRSLWSEPWGLLHARLDEDALGNGRIVLLEAAGVFE
DGLAFETRGKTPAAAPRSAEELLLPTDAAVLLHLAVPGTHASGQVYSVLDSSKEGHDQNSFRFRTIARVL
RDNTNGIDEREVSLGEGNLSLLTEREVTPEMSTIPLARLMRDGRGGLLYDPEYIAPTLRMSASPALMLLG
KRLLEILAEKMGPLSRAMRPRGRFEAGTAPLDVATYWFLHALSTSAPVLRHLCATRHAHPEQFYLELARL
AGALSTFATETSLDELPDYDHRNPGHAFRALDAHIRKHLEMIMPTNTITLTFTPAAPYIQEADVLDERCL
RRARWILGIRANLGEADLIDGVPRLIKVCSARFVPELVRRALPGLTLLHLPVPPSAIRAEADKQYFAIDL
SGPCWEHILQSKRVGVYIPGEIAEADFDLTVVVEPNV
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|374308961|ref|NC_016631.1|:3552987-3554360 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGAAGTCTCTTAGCAGAGTGGTCTGGACCGAGGGCATGTATATGAGCCCCCAACATTTCCAGGCACAGA
GCCGATTTTATGAAGACACCGTTGATTTCGTCACACGGAGTCTATGGTCTGAGCCGTGGGGCCTGCTCCA
CGCACGCCTTGATGAAGATGCCCTGGGGAACGGGCGAATCGTGTTGCTTGAGGCAGCAGGCGTATTTGAA
GACGGCCTTGCGTTTGAAACCCGCGGAAAAACTCCTGCAGCAGCACCACGCAGCGCTGAAGAACTCTTAC
TTCCGACAGACGCCGCTGTACTCCTGCATCTGGCAGTACCGGGCACGCATGCTTCTGGCCAGGTCTACAG
CGTGCTCGATTCGTCGAAAGAAGGGCACGATCAGAACTCCTTCCGATTCCGTACGATAGCGCGCGTTTTG
CGCGATAACACGAATGGAATCGATGAACGTGAAGTTTCGCTCGGAGAAGGAAACCTCTCATTGCTTACGG
AACGGGAAGTGACTCCGGAGATGTCGACCATCCCGCTTGCGCGCTTGATGCGTGATGGCCGGGGTGGTTT
GCTGTATGACCCTGAATACATCGCTCCTACACTGCGCATGTCTGCCAGTCCCGCGCTGATGTTGCTGGGC
AAGCGTCTGCTCGAAATTCTTGCCGAAAAAATGGGGCCGCTCTCACGCGCCATGCGCCCGCGCGGGAGGT
TTGAAGCCGGCACCGCCCCGCTCGACGTAGCGACTTACTGGTTTCTCCATGCACTGTCCACCTCTGCGCC
TGTATTGCGGCATCTATGCGCTACACGCCATGCGCACCCCGAGCAGTTTTATCTGGAACTCGCGCGACTG
GCAGGCGCACTCTCAACGTTTGCTACGGAAACTTCACTCGATGAGCTGCCTGATTACGACCACCGCAACC
CAGGACATGCGTTTCGGGCACTCGATGCACACATTCGCAAGCATCTTGAGATGATCATGCCGACCAACAC
GATCACACTCACCTTCACACCGGCTGCTCCTTACATTCAGGAAGCTGATGTTCTGGACGAGCGGTGTCTG
CGGCGCGCCCGCTGGATACTGGGCATTCGGGCCAATCTCGGCGAAGCGGACCTGATCGACGGTGTGCCAA
GACTCATCAAGGTTTGCTCCGCGCGCTTCGTACCCGAACTGGTGCGCCGTGCTCTGCCTGGTCTCACCCT
GCTGCATCTGCCTGTGCCGCCTTCCGCTATTCGCGCAGAAGCGGACAAACAATACTTCGCGATTGATCTA
TCAGGCCCCTGCTGGGAACACATTCTGCAAAGCAAGCGCGTCGGCGTTTATATTCCCGGAGAGATTGCCG
AAGCGGACTTTGATCTCACAGTGGTGGTCGAGCCCAACGTCTGA