SecReT6
Protein ID: 374311785
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2882
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3554706..3555497 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDG8NPU6
KEGG IDgma:AciX8_2882
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.20E-38, Aligned region: 22..226
Protein Sequence: 263 a.a.     [Download]
>gi|374311785|ref|YP_005058215.1| DotU family type IV / VI secretion system protein [Granulicella mallensis MP5ACTX8]
MAVSSPSAAAPPARPAAAAHTIASLFSEVLTAILRIRYGKQTIGDTHSFREHMRRLLQTAMQEARSLGYS
SEHIQMAVLATVGFLDESVLNLASAAPADWARRPMQEELFGGHVAGETFFQNFAALLREENSTKVADVLE
LHCHCLMLGYKGRYAFGNAGELAQLLRAAQEKIVRARGGAGTLLPGPATLPQPAATGRDRWSYRLMIAAM
VLAAVVILCFVIYSLSLKVGAAGLAQNKMMPGPVLQHGTLQVPATDVRPEWRG
 
Nucleotide Sequence: 792 bp     [Download]
>gi|374308961|ref|NC_016631.1|:3554706-3555497 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGGCAGTTAGTTCACCTTCGGCGGCTGCACCACCTGCTCGACCTGCTGCGGCAGCACACACGATCGCCT
CTCTCTTCAGCGAAGTCTTGACCGCAATTCTCCGCATTCGCTATGGCAAACAGACCATTGGCGACACGCA
TTCCTTTCGCGAGCACATGCGCAGACTGCTGCAGACCGCCATGCAGGAAGCTCGTAGTCTGGGGTATTCG
AGCGAACATATCCAGATGGCAGTGCTAGCCACCGTCGGCTTTCTTGATGAGAGCGTGCTGAACCTTGCCA
GCGCGGCTCCCGCGGATTGGGCCCGACGCCCTATGCAGGAAGAGCTTTTCGGTGGACACGTCGCAGGCGA
GACCTTCTTCCAAAACTTCGCTGCCCTGCTGCGCGAAGAAAACAGCACGAAGGTAGCCGATGTGCTGGAG
CTGCACTGTCACTGCCTGATGCTTGGCTACAAGGGACGCTATGCCTTCGGGAACGCGGGTGAACTTGCGC
AGTTGCTGCGCGCCGCACAGGAGAAGATCGTTCGCGCTCGTGGAGGAGCAGGCACTTTGCTGCCAGGCCC
TGCCACGCTGCCGCAGCCCGCTGCCACAGGACGCGATCGGTGGAGCTACCGCCTGATGATCGCGGCGATG
GTGCTGGCAGCAGTGGTAATACTCTGCTTCGTGATCTACAGCCTGTCTCTAAAGGTGGGTGCAGCAGGAC
TCGCGCAAAACAAAATGATGCCAGGCCCCGTGTTACAGCATGGAACCCTGCAAGTTCCAGCGACAGATGT
GCGGCCCGAGTGGCGAGGATAG