SecReT6
Protein ID: 374313059
SecReT6 ID925
T6SS typeiii
Gene symbol-
Locus tagAciX8_4180
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]5333227..5333727 [+]
Producthypothetical protein
NoteTssB
UniProt IDG8NRL8
KEGG IDgma:AciX8_4180
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 0.0037, Aligned region: 50..127
Protein Sequence: 166 a.a.     [Download]
>gi|374313059|ref|YP_005059489.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MPLVKVVRKGVTPAVRKVPTSTAAAMLPMTLNRVGGEAVSETEDLVKVEDLGDAFRKFEPKLSFRGYAGP
EETEFRSELEFRSIKDFDPENLQKRQEVKDAEGNSHFLRNDLADLKQNIDLLYRLKDRWKLPAVRRAWSN
AAQREEIVNALGKLRSELERVAEGEK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|374308961|ref|NC_016631.1|:5333227-5333727 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGCCTCTGGTAAAAGTTGTTCGTAAAGGAGTTACCCCCGCGGTTCGAAAGGTTCCCACCTCGACGGCCG
CCGCGATGCTGCCGATGACGCTGAATCGCGTTGGTGGCGAAGCCGTCTCCGAGACGGAAGACCTGGTGAA
GGTAGAGGACCTCGGCGATGCGTTCCGGAAGTTCGAGCCCAAGCTCAGCTTTCGTGGCTACGCCGGCCCC
GAGGAGACAGAGTTCCGCTCCGAGTTAGAGTTCCGCTCCATCAAGGACTTCGATCCCGAGAACCTGCAGA
AGCGGCAGGAGGTCAAGGATGCAGAGGGTAATTCTCACTTCCTGCGCAACGACCTGGCCGATCTGAAGCA
GAACATCGACCTGCTCTACCGGTTGAAAGACCGCTGGAAGCTGCCGGCAGTACGCCGCGCCTGGAGCAAT
GCCGCCCAGCGCGAGGAGATCGTCAATGCTCTCGGCAAGCTGCGCTCCGAACTCGAACGTGTTGCGGAAG
GGGAGAAGTAA