SecReT6
Protein ID: 374313060
SecReT6 ID925
T6SS typeiii
Gene symbol-
Locus tagAciX8_4181
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]5333731..5335071 [+]
Producthypothetical protein
NoteTssC
UniProt IDG8NRL9
KEGG IDgma:AciX8_4181
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 446 a.a.     [Download]
>gi|374313060|ref|YP_005059490.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MAETTTLNRTTEQILGNSPARELLQDIFADLHPGLTNEKRDLASIFSAQSAKEFLGQLTNFEQLISADDS
YEQTVKKLQGQIDSAEGIRDQLLSQIFDQIRTLELSYRQIQLFFENSKVGDGKIRKPVELFILNADPKAM
QDIFSMNIAALEHFIVQRNDNFNFRDDICNLVIPGYYPQPIREKFEQIANAWGMLLIGDLDDETSFKNVE
RNFLPGGKYEFLKRPEDQAASDVCLMGYLQLRAPHWFEKDSDASEGLYSPPSMVFAGAVARADDAQGMAQ
GPVGSRFGRVHGAAKARIEPLIGQMEHLSMERQLIPIIRDADNHLCFYGCRTQADDPYGVLKFFTSYRIL
RYLERCCRHYLLQVAGQVLTRDFMDQQIETPLKRLLDEQVEQGTILGYDLFVDKDSNKRMQGICDITLNV
MPTGPAETFVLKIDVPEFSRPEPAKN
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|374308961|ref|NC_016631.1|:5333731-5335071 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGGCTGAGACCACGACATTGAACCGCACCACCGAGCAGATCCTGGGCAACAGCCCCGCACGTGAGTTGC
TTCAGGACATCTTCGCCGATCTTCATCCCGGCCTGACCAACGAAAAGCGCGACCTGGCCAGCATCTTCTC
CGCCCAGTCGGCCAAGGAGTTCCTCGGCCAGCTCACGAACTTCGAGCAACTGATCAGCGCCGACGACAGC
TACGAGCAGACCGTCAAGAAGCTGCAGGGCCAGATCGACAGCGCCGAAGGCATCCGCGATCAACTCCTGT
CGCAGATCTTCGACCAGATCCGCACGCTGGAACTCTCGTACCGCCAGATCCAGCTCTTCTTTGAGAACTC
CAAGGTGGGCGACGGCAAGATTCGCAAGCCCGTCGAGCTCTTCATCCTCAACGCCGACCCGAAGGCGATG
CAGGATATCTTCTCCATGAATATCGCCGCGCTGGAGCACTTCATCGTGCAGCGCAACGATAACTTCAACT
TCCGCGACGACATCTGCAACCTGGTGATTCCGGGTTATTATCCGCAGCCTATCCGCGAGAAGTTCGAACA
GATCGCCAATGCCTGGGGCATGCTCCTGATCGGCGACCTGGACGATGAGACCTCCTTCAAGAACGTCGAG
CGTAACTTCCTGCCCGGCGGCAAGTATGAGTTCCTGAAGCGGCCCGAAGACCAGGCTGCCTCGGACGTCT
GTCTGATGGGTTATCTGCAGTTGCGCGCCCCTCACTGGTTCGAAAAGGACAGTGACGCCAGCGAAGGGCT
CTACAGCCCTCCGTCGATGGTCTTTGCAGGTGCGGTTGCACGCGCGGACGATGCGCAGGGCATGGCGCAG
GGTCCGGTCGGCTCCCGCTTCGGCCGGGTCCATGGCGCGGCCAAAGCTCGCATCGAGCCGCTCATCGGCC
AGATGGAGCACCTCTCCATGGAACGCCAGCTGATCCCGATCATTCGCGATGCGGACAACCACCTCTGCTT
CTACGGTTGCCGTACGCAGGCCGACGATCCGTACGGCGTGCTCAAGTTCTTTACCTCCTACCGCATCCTG
CGGTACCTGGAACGCTGCTGCCGCCACTACCTGCTGCAGGTCGCGGGCCAAGTGCTGACGCGCGACTTCA
TGGACCAGCAGATCGAGACTCCTCTGAAGCGTCTGCTGGACGAGCAGGTAGAGCAGGGCACGATTCTGGG
CTATGACCTGTTCGTCGACAAGGATTCCAACAAACGCATGCAGGGCATCTGCGACATCACGCTGAACGTG
ATGCCTACCGGACCTGCTGAAACCTTCGTGCTCAAGATCGATGTACCGGAGTTCAGCCGCCCGGAACCCG
CAAAGAACTAG