SecReT6
Protein ID: 374313065
SecReT6 ID925
T6SS typeiii
Gene symbol-
Locus tagAciX8_4186
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]5337055..5338746 [+]
Producthypothetical protein
NoteTssF
UniProt IDG8NRM4
KEGG IDgma:AciX8_4186
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 563 a.a.     [Download]
>gi|374313065|ref|YP_005059495.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MSSHTPNVLEIDRKLRDDFRRRVKDFGVSTETTDPLLAVLFRTVAQQIDQVYSDTAQLRQSLLHELMSGL
QVQQYLATPAQAAVRLINDLSEPRVLRAGTELNAVASTGERLSFGLDATFEVSQARIALALSYQDQSLRL
LTGVEMSDTIQAMRPSSDPVPVGLGPQPALYIAVENLPPGLLNRHSLFFELSPGTYPVQHALCHEPWWIF
GEDGDLSGEGLMRPKRINGGVYRLEFQLGQNEPVGMFDAPLPSIPNGFYTGRQYLFPPMHAGQPLLCRVP
RLLEPALTRILNRDAAQLLSEPRLWIKIPMPPGVPALHHAINGILLHTMTASNVFARNQTIHFERDGISI
PVVREGGTPEHLVAPLTVMSVDNDAYEAATRPGADASAGRFELHNNRLTLYPGTHSDGTPHAAANIRLWL
TNGALGNRVGPGDITSFANAASLTGIRLTPFTAASGGSDGEHIASEERRFADALLTRGRIVTRQDLETAA
LAVDRRILNAVTDSGMVRKEEGIRRVERLHLTLDSHAFSKPEIELPALKSQIETSLGARLVQGLELEVAF
TWN
 
Nucleotide Sequence: 1692 bp     [Download]
>gi|374308961|ref|NC_016631.1|:5337055-5338746 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGAGCAGCCATACCCCAAACGTTCTTGAGATCGACCGCAAGCTCCGCGACGACTTCCGTCGCCGCGTAA
AGGACTTCGGCGTCAGCACCGAGACGACCGATCCCCTGCTCGCCGTACTCTTCCGCACCGTGGCTCAGCA
GATCGATCAGGTCTACAGCGACACCGCGCAGCTTCGCCAATCGCTGCTGCATGAGCTGATGAGCGGCCTG
CAGGTGCAGCAATATCTTGCGACGCCCGCACAGGCGGCGGTCCGGCTGATCAACGATCTCAGCGAGCCGC
GCGTGCTGCGCGCAGGCACGGAGCTGAACGCTGTCGCCTCCACCGGCGAACGGCTCTCCTTCGGCCTCGA
CGCGACCTTTGAAGTCTCGCAGGCGCGCATCGCGCTTGCCCTCAGCTATCAGGACCAGTCCCTGCGCCTG
CTGACCGGCGTGGAGATGAGCGATACCATCCAGGCGATGCGGCCTTCGTCCGATCCGGTCCCCGTGGGTC
TGGGGCCGCAGCCGGCGCTGTATATCGCCGTTGAAAACCTGCCGCCCGGACTACTCAACCGTCACAGTCT
TTTCTTTGAGCTGAGCCCCGGCACCTACCCCGTGCAGCATGCGCTCTGCCATGAGCCATGGTGGATCTTC
GGCGAGGACGGCGATCTCTCCGGCGAAGGCCTGATGCGCCCCAAGCGCATCAACGGCGGTGTCTACCGGC
TCGAGTTTCAGTTGGGCCAGAATGAGCCGGTCGGCATGTTCGATGCGCCGCTGCCTTCGATCCCCAATGG
CTTCTACACAGGCCGGCAGTACCTGTTTCCGCCCATGCACGCAGGCCAACCCCTGCTGTGCCGGGTGCCG
CGTCTGCTGGAACCGGCGCTTACCCGCATCCTCAATCGCGACGCGGCCCAGCTGCTCTCCGAGCCTCGGC
TCTGGATCAAGATTCCGATGCCGCCCGGTGTACCGGCGCTGCACCACGCGATCAACGGCATCCTGCTGCA
CACCATGACAGCTTCGAACGTCTTTGCGCGCAACCAGACGATCCACTTCGAGCGCGACGGCATCTCGATC
CCCGTCGTCCGCGAAGGCGGCACGCCGGAGCACCTGGTGGCTCCGCTGACCGTGATGAGCGTCGATAACG
ATGCCTATGAGGCAGCCACTCGCCCTGGCGCGGATGCCTCCGCCGGACGCTTTGAGCTGCACAACAATCG
CCTGACGCTCTACCCCGGCACGCACAGCGACGGCACGCCACACGCAGCCGCGAACATCCGCCTGTGGCTA
ACCAACGGCGCACTCGGCAATCGGGTTGGCCCCGGCGACATCACCAGCTTTGCCAATGCTGCCTCGCTGA
CCGGGATCAGGCTCACGCCTTTTACCGCAGCCTCGGGCGGCTCCGACGGAGAGCACATCGCCAGCGAAGA
GCGGCGCTTTGCCGACGCCCTGCTGACGCGCGGCCGCATCGTGACGCGGCAGGACCTGGAGACTGCCGCA
CTCGCTGTAGATCGCCGCATCCTCAATGCGGTGACGGACTCCGGCATGGTGCGCAAAGAAGAAGGAATTC
GGCGCGTGGAACGGCTGCACCTCACGCTCGACTCGCACGCCTTCTCGAAGCCGGAGATCGAGCTGCCCGC
GCTGAAGTCACAGATTGAAACCTCGCTCGGCGCGCGCCTGGTGCAGGGGCTGGAACTGGAGGTAGCGTTC
ACATGGAACTAG