SecReT6
Protein ID: 374313066
SecReT6 ID925
T6SS typeiii
Gene symbol-
Locus tagAciX8_4187
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]5338737..5339735 [+]
Producthypothetical protein
NoteTssG
UniProt IDG8NRM5
KEGG IDgma:AciX8_4187
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.00E-12, Aligned region: 166..311
PASTA [PF03793], Evalue: 0.0011, Aligned region: 34..86
Protein Sequence: 332 a.a.     [Download]
>gi|374313066|ref|YP_005059496.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MELASAIPTPIPASTARMRRMPALAEGTHAHSHSIHSALASLTALGISQHRIVVRCTGRESVAAGTVVRQ
EPAAGMPIFPDTSVHLDIAGLGFSHSLPVGMWDSGGETHAGTREILEPFDDPLEKLRHWFHEGAPLFRIS
PDDPAACARWLKLFGINAAEWPRPLWYRLASLIASVSQLSCSQDGCAFVLRTLLDLPVESFSYHSSVSAL
PSTALSSLSTHASRLGVDLLMGDSVEDLATLQVEIGPVSLETYERYTESEEGAALLRRSLEMIMPVSTRY
DVRWSVLDRNQAPRLGMKEHNARLGINTHMGRQLSSAPQNNQPQESTSWSNA
 
Nucleotide Sequence: 999 bp     [Download]
>gi|374308961|ref|NC_016631.1|:5338737-5339735 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGGAACTAGCCTCCGCTATTCCCACTCCCATTCCTGCCTCGACGGCACGGATGCGCCGCATGCCTGCCC
TGGCCGAAGGCACCCACGCGCACAGCCACTCCATCCACTCGGCTCTGGCTTCGCTAACGGCGCTCGGAAT
CAGCCAGCATCGCATCGTGGTGCGCTGCACAGGGCGAGAGTCCGTCGCGGCGGGCACCGTGGTACGCCAG
GAACCGGCGGCAGGCATGCCGATCTTTCCCGATACCTCCGTGCATCTCGACATCGCCGGACTGGGCTTCT
CGCACTCGCTTCCCGTCGGCATGTGGGACTCCGGCGGCGAGACCCATGCAGGCACGCGCGAGATCCTCGA
ACCCTTCGACGATCCGCTCGAGAAGCTGAGGCACTGGTTCCATGAGGGTGCGCCGCTCTTCCGCATCTCG
CCGGACGACCCCGCGGCCTGCGCCCGCTGGTTGAAGCTCTTTGGCATTAACGCCGCCGAGTGGCCGCGTC
CGCTCTGGTACCGATTGGCCTCGCTGATCGCCAGCGTCTCGCAGCTTAGCTGCTCGCAGGATGGCTGTGC
TTTTGTACTGCGTACGCTGCTCGATCTTCCCGTGGAGAGCTTCTCATATCATTCGTCAGTCTCTGCCCTG
CCCTCGACCGCACTCTCCTCGCTGAGCACGCACGCCTCGCGGCTGGGCGTCGATCTGCTGATGGGAGACT
CCGTTGAAGATCTCGCCACCTTGCAGGTAGAGATCGGGCCGGTCTCGCTCGAAACTTACGAACGTTACAC
CGAAAGCGAAGAGGGTGCGGCTCTGCTGCGCCGCTCGCTCGAGATGATCATGCCCGTCTCCACCCGCTAT
GACGTGCGCTGGTCCGTGCTGGACCGCAACCAGGCCCCACGTCTTGGGATGAAAGAACACAACGCCCGTC
TCGGCATCAACACGCACATGGGAAGACAGCTCTCCTCCGCACCACAAAACAATCAGCCGCAAGAATCTAC
CAGTTGGAGCAACGCATGA