SecReT6
Protein ID: 374313067
SecReT6 ID925
T6SS typeiii
Gene symbol-
Locus tagAciX8_4188
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]5339732..5341531 [+]
Producthypothetical protein
NoteTssK
UniProt IDG8NRM6
KEGG IDgma:AciX8_4188
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.10E-05, Aligned region: 158..230
Protein Sequence: 599 a.a.     [Download]
>gi|374313067|ref|YP_005059497.1| hypothetical protein [Granulicella mallensis MP5ACTX8]
MNESRPETRNLLNLRSVNWEHGMLLTPDHFLRQEQYLESLSAWGLRYLAAANGLVGGGVRIPESDLGTVR
FDPEVTLNESAEHLDISVSRARGITPSGAIVDIETAGSISNRFSKDHLAGVAESVVYVVLDPLVRIKSNG
VIDSFNPQMRTERIPSYRIALNVTAAERANGLAVGRIRRPATGMYFEADPGFIPACISVAGHSELMTGSR
RILDAINRLASGYAELHRAMREFMVIFTERGLETEVDRDSMAFAERMVLELQDTAYALLDRTQTPENFFG
RVRRMLHSAAIFFDLATGMQQYYDMLRETGESELLGLIELQKHTLQLGRSLRLDEDLGLEVRKMLQSLAG
LEKLERALEGKYIDFRKSASLESTNFIFDRGGKALYKLAARPSRVQGVADEMTIIFSNLRLEGRDRYRLI
LVGDRATPWLRGTSIGAEIRLNEGSGFRRESLILTGDVKFDEQNNIELDFEAPDVPTITDLRVTVPAYHT
VHTALLFLRHRFYASRQDNLEARTVERESERTGILPRPENVSTYAAKSTRTEIPAPVAQRPMTQPIERME
STTPATPAPVIQPPWMPRDNPANGAEEDASNRPRRRRLE
 
Nucleotide Sequence: 1800 bp     [Download]
>gi|374308961|ref|NC_016631.1|:5339732-5341531 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGAACGAATCGCGGCCAGAAACGCGCAATCTGTTGAACCTGCGGTCGGTGAACTGGGAGCATGGCATGC
TTCTGACGCCCGATCATTTTCTGCGACAGGAGCAGTATCTCGAGTCGCTTTCGGCGTGGGGCCTGCGCTA
TCTCGCCGCGGCCAACGGCCTGGTGGGCGGCGGCGTGCGGATTCCCGAGAGCGATCTCGGCACCGTCCGC
TTCGATCCCGAAGTGACGCTCAATGAGTCGGCGGAGCACCTCGACATCTCCGTGTCGCGTGCGCGCGGCA
TTACGCCCTCCGGCGCCATCGTCGACATCGAAACCGCGGGCAGCATTTCGAACCGCTTCTCGAAGGACCA
CCTCGCGGGCGTCGCCGAGTCCGTGGTCTACGTCGTCCTCGATCCGCTGGTTCGCATCAAGAGCAACGGC
GTCATCGACTCTTTCAATCCGCAGATGCGCACCGAGCGCATCCCCAGCTACCGCATCGCGCTCAATGTCA
CGGCAGCGGAACGAGCTAACGGCCTAGCCGTAGGCCGCATTCGCCGTCCTGCCACAGGCATGTACTTCGA
GGCAGACCCAGGCTTTATTCCCGCGTGCATCTCGGTCGCCGGACACTCCGAGTTGATGACGGGCAGCCGC
CGCATCCTGGACGCCATCAATCGCCTCGCCTCGGGCTATGCGGAGCTGCATCGCGCCATGCGCGAGTTCA
TGGTCATCTTCACCGAGCGCGGTCTCGAGACGGAAGTCGACCGCGACTCGATGGCGTTTGCCGAACGCAT
GGTGCTCGAACTGCAGGACACCGCGTACGCGCTGCTCGATCGCACTCAAACCCCTGAGAACTTCTTCGGT
CGCGTGCGCCGGATGCTGCACTCCGCCGCCATCTTCTTCGATCTCGCGACCGGCATGCAGCAGTACTACG
ACATGCTGCGCGAGACGGGCGAAAGCGAACTGCTCGGCCTGATCGAGCTTCAGAAGCATACGTTGCAACT
GGGCCGCAGCCTGCGGCTCGACGAGGACCTCGGGCTGGAGGTGCGCAAGATGCTTCAGTCGCTCGCCGGG
CTGGAGAAGCTCGAGCGCGCGCTCGAAGGCAAGTACATCGACTTCCGCAAGAGCGCCTCGCTCGAGAGCA
CCAACTTCATCTTCGACCGCGGCGGCAAGGCGCTGTACAAGCTGGCGGCGCGACCGTCCCGCGTGCAGGG
CGTTGCGGACGAGATGACCATCATCTTCTCGAACCTGCGGCTCGAAGGCCGCGACCGCTACCGGCTCATC
CTGGTCGGCGACCGCGCCACACCGTGGCTTCGCGGCACGTCGATCGGCGCGGAGATCCGGCTGAATGAGG
GCTCGGGCTTCCGCCGCGAGAGCCTCATCCTCACCGGCGACGTAAAGTTCGACGAGCAGAACAACATCGA
GCTCGACTTCGAAGCGCCCGACGTTCCCACAATCACCGACCTGCGCGTCACGGTGCCCGCGTATCACACC
GTGCACACCGCGCTGCTCTTCCTGCGCCACCGCTTCTATGCCAGCCGCCAGGACAACCTGGAGGCGCGTA
CCGTCGAGCGCGAATCGGAACGCACCGGCATCCTGCCGCGCCCGGAGAACGTCTCCACGTACGCCGCAAA
GAGCACGCGTACCGAGATTCCCGCGCCAGTAGCGCAACGGCCTATGACGCAGCCGATCGAGCGCATGGAG
AGCACGACACCAGCCACGCCGGCACCCGTCATCCAGCCGCCGTGGATGCCTCGCGATAACCCTGCGAATG
GAGCTGAGGAAGACGCCTCCAACCGCCCACGACGCCGCCGTCTGGAATAA