SecReT6
Protein ID: 374313069
SecReT6 ID925
T6SS typeiii
Gene symbol-
Locus tagAciX8_4190
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]5344302..5346458 [+]
Productforkhead-associated protein
NoteFha
UniProt IDG8NRM8
KEGG IDgma:AciX8_4190
PDB IDNA
Domain hit(s) vs Pfam DUF1080 [PF06439], Evalue: 4.20E-16, Aligned region: 37..189
DUF1080 [PF06439], Evalue: 4.20E-16, Aligned region: 196..360
DUF1080 [PF06439], Evalue: 4.20E-16, Aligned region: 468..491
FHA [PF00498], Evalue: 2.70E-14, Aligned region: 639..700
Protein Sequence: 718 a.a.     [Download]
>gi|374313069|ref|YP_005059499.1| forkhead-associated protein [Granulicella mallensis MP5ACTX8]
MSLSPLPQYYRKSAALFGAFALATSLSAAPVPDPSLSLFNGTSMAGWNAHGTWGASNGNLTSNGTGNRNV
LTAVPFADFNLQFEYFESAPTGAKLRLWASRENNGGFTIDLDNSDAPSGIGGIETISVSSIKNLPSAWHR
VQVDASHGQITVRVDGLPSGTASGLGSRAGYIGFEATGGAVLQVRNIRLTPLDPGSTFNNTDLSGWKSIA
RNPNAKGGLGHSVEKTFTMGIGGGSTKPHEAKWSVHNGAIHGESGPGGLENGNTAEDAIIQLVASVKGEI
KKENFTALLLRNTAGQLEGGYEVGIGPYAGGIEHLESHAFGSAETPVNETIVIGGRTIAIWINGVLTTVH
TDSRPDSNNSAQGARTTAGAMTLLLPNGGEQLDVQKFITTVLPKTYGAPAHTPPPPPPTPQPTPQTAAAA
APAAPSVAETALIQQQQSAAKKDATDQQNKQKVASLMGQALATSDPQQQMSAYGQVVQIDPSNAAAVQGY
KEAQQKVQAQQEEQAKASTTAVVQQHDEQTREQQTSESLSKAQSAFLAGHLAAASGALAIAERLSPSNPL
AHDLRTRISAAQMLRSRLVMLGSGAGLLALVGMIAMWMRRRKMQRFPVLEITRGLDSGRTHPIDKDIVRI
GAVAQDGGQKNDIVIRDVEHAISRFHCEIVKRDGQLYVNDLNSSNGTRLNGAQIKPGSPEPLRRGSNILL
ANAVELRFDYDRGAKTKN
 
Nucleotide Sequence: 2157 bp     [Download]
>gi|374308961|ref|NC_016631.1|:5344302-5346458 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGAGCCTGTCCCCGTTGCCTCAGTACTATCGAAAATCTGCCGCTCTCTTTGGCGCCTTCGCGCTTGCCA
CCAGCCTGTCTGCCGCGCCCGTTCCCGATCCTTCGCTCTCGCTCTTCAACGGGACTTCGATGGCGGGTTG
GAATGCTCACGGAACCTGGGGCGCAAGCAACGGAAATCTCACCAGCAATGGCACGGGCAACCGCAATGTG
CTCACCGCGGTTCCGTTCGCCGACTTCAATCTGCAGTTTGAGTACTTCGAGAGCGCTCCCACCGGAGCCA
AGCTGCGCCTGTGGGCCTCGCGCGAGAATAACGGCGGCTTCACCATCGATCTCGATAACAGCGATGCTCC
TTCGGGTATCGGCGGCATTGAGACCATCTCGGTCTCCTCGATCAAGAATCTTCCGTCGGCCTGGCATCGC
GTCCAGGTAGACGCCTCCCACGGCCAGATCACGGTTCGTGTCGATGGCCTGCCTTCGGGCACGGCCTCCG
GGCTCGGTTCACGCGCGGGTTATATCGGCTTCGAGGCCACCGGCGGCGCAGTGCTGCAAGTGCGCAATAT
CAGGCTCACCCCACTCGATCCCGGCAGCACCTTCAACAATACGGACCTCAGCGGCTGGAAGAGCATCGCG
CGCAATCCCAATGCCAAGGGTGGGCTGGGTCACTCTGTCGAGAAGACCTTCACCATGGGCATCGGCGGCG
GCAGCACCAAACCGCATGAGGCCAAGTGGTCAGTCCATAACGGCGCGATCCACGGAGAAAGCGGCCCCGG
CGGTCTGGAGAACGGCAATACCGCCGAGGACGCCATCATTCAACTGGTGGCGTCGGTCAAAGGCGAGATT
AAAAAAGAGAACTTCACGGCTCTCCTATTGCGCAACACCGCAGGACAGCTTGAAGGGGGCTATGAGGTCG
GTATCGGCCCCTACGCGGGCGGTATCGAACACCTCGAAAGCCATGCATTCGGCAGCGCCGAGACCCCGGT
CAACGAGACCATCGTCATCGGTGGGCGCACCATCGCCATCTGGATCAACGGCGTCCTGACGACCGTACAC
ACCGACTCCCGCCCGGACAGCAACAACAGCGCGCAGGGAGCCCGCACCACCGCCGGCGCCATGACCCTGC
TCCTGCCGAACGGCGGCGAACAGCTGGACGTGCAGAAGTTCATCACGACGGTCCTGCCGAAGACCTACGG
CGCACCGGCACACACTCCACCGCCACCGCCGCCTACACCCCAGCCGACACCCCAAACCGCCGCAGCCGCT
GCGCCGGCGGCCCCCTCAGTAGCAGAGACGGCATTGATCCAGCAACAGCAGAGTGCCGCGAAGAAGGATG
CCACCGATCAACAGAACAAGCAGAAGGTGGCGTCGCTCATGGGGCAGGCTCTGGCGACATCCGACCCGCA
ACAACAGATGAGCGCGTACGGCCAGGTCGTCCAGATCGATCCGTCGAACGCCGCAGCCGTGCAAGGTTAT
AAGGAAGCGCAGCAGAAGGTCCAGGCCCAGCAGGAAGAACAGGCCAAGGCTTCTACCACTGCCGTGGTGC
AGCAGCACGACGAGCAGACGCGCGAACAGCAGACCAGCGAATCGTTGTCGAAGGCGCAGAGTGCCTTCCT
CGCGGGACATCTGGCGGCTGCCAGCGGTGCCCTTGCCATTGCGGAGCGCCTGTCGCCCAGCAATCCCCTG
GCCCACGATCTGCGGACTCGCATCAGCGCCGCGCAGATGCTTCGTTCGCGACTTGTCATGCTGGGCAGTG
GCGCAGGCCTGCTGGCCCTCGTGGGAATGATTGCGATGTGGATGCGGCGCAGGAAGATGCAGCGCTTCCC
TGTGCTTGAGATCACGCGCGGGCTCGACTCTGGCCGCACGCACCCGATCGACAAAGACATCGTCCGCATC
GGCGCGGTCGCGCAGGACGGCGGCCAGAAGAACGACATCGTGATCCGCGACGTAGAGCATGCCATCTCGC
GCTTCCACTGCGAGATCGTCAAGCGTGATGGCCAGCTTTACGTCAACGATCTCAACAGCTCGAACGGCAC
CCGCTTGAACGGCGCACAGATCAAGCCGGGCAGTCCGGAACCTCTACGCAGAGGCAGCAATATTCTGCTG
GCTAATGCCGTGGAACTGCGCTTCGATTATGACCGTGGCGCGAAGACAAAAAACTGA