SecReT6
Protein ID: 374330204
SecReT6 ID533
T6SS typei1
Gene symbol-
Locus tagPSE_1856
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1960615..1961124 [+]
Producthypothetical protein
NoteTssB
UniProt IDG8PFZ8
KEGG IDpsf:PSE_1856
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.20E-56, Aligned region: 6..159
Protein Sequence: 169 a.a.     [Download]
>gi|374330204|ref|YP_005080388.1| hypothetical protein PSE_1856 [Pseudovibrio sp. FO-BEG1]
MAGKEGSVAPKERINIRYVPATGDQQEEVELPLRLVMLGDYNGKEDDTPLEDRELLSVDKNTFASVMKEA
GLERELTVKNTLVEDEDAQLAVNLKFEGLKDFEPDSIVKQVPELKKLIDLREALVALKGPLGNIPAFRNR
LEQILQDKEQREKLLSELDAVVSSQEETS
 
Nucleotide Sequence: 510 bp     [Download]
>gi|374328350|ref|NC_016642.1|:1960615-1961124 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGGCTGGCAAGGAAGGTTCTGTTGCGCCAAAAGAGCGAATTAATATTCGTTATGTTCCGGCAACTGGTG
ATCAGCAGGAAGAAGTTGAACTGCCGCTGCGTCTAGTCATGCTGGGTGATTACAACGGCAAAGAAGATGA
CACGCCTCTTGAAGACCGCGAGCTGCTTTCCGTCGATAAAAATACCTTTGCATCGGTTATGAAAGAAGCT
GGTCTGGAGCGTGAGCTGACAGTTAAAAATACCCTTGTTGAAGATGAGGATGCGCAGCTGGCCGTCAACT
TGAAGTTTGAAGGCCTGAAGGACTTTGAGCCAGACTCCATTGTTAAACAAGTGCCTGAACTTAAAAAGCT
AATTGATCTTCGTGAAGCGCTGGTTGCTTTGAAAGGGCCGCTTGGAAACATACCGGCATTCCGTAACCGG
CTCGAGCAGATTTTGCAGGACAAAGAGCAAAGGGAAAAGCTTTTGTCAGAGCTGGATGCAGTCGTGTCTT
CTCAGGAAGAAACCAGCTGA