SecReT6
Protein ID: 374330205
SecReT6 ID533
T6SS typei1
Gene symbolevpB
Locus tagPSE_1857
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1961221..1962714 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDG8PFZ9
KEGG IDpsf:PSE_1857
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.30E-184, Aligned region: 69..494
Protein Sequence: 497 a.a.     [Download]
>gi|374330205|ref|YP_005080389.1| type VI secretion protein EvpB [Pseudovibrio sp. FO-BEG1]
MVDVSASAGQPDVAGAGAAISLLDQIMEETRIRPEDEESYSIARRGVEAFISDLLSSQEVDQRINRVLVD
RMISELDLKVSSQLDEILHDEKFQELESAWRGLKLLVDRTDFRENIKIDVLSVSKDKLLEDFETSPEVVQ
SGLYKHVYSSGYGQFGGEPVGAMIANYDFGPGARDVKLLQFAASVGAMAHAPFIAAAGPKMFDVDEYVDL
PAQKDLFSIYEGPRFRKWMGFRQSEDSRYVGLTCPRFLLRMPYDAEENPVDAFVYNENVTEEHESYLWGN
TSFLMATRLTESFAKYRWCPNIIGPQSGGAVHDLPVHVFEAFGQLEEKIPTEVLVTDRREFELAEEGFIA
LTMRKGSDNAAFFSANSAQKPKIFQNTKEGKEAETNYKLGTQLPYMMIVNRLAHYIKVLQREQIGSWKER
EDLERELNTWLRQYVADQENPPQDVRSRRPLRAAEVIVSDVEGDPGWYQVSLKVRPHFKYMGANFELSLV
GKLDKDS
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|374328350|ref|NC_016642.1|:1961221-1962714 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGGTAGATGTATCAGCCTCTGCCGGCCAGCCGGATGTTGCCGGTGCGGGCGCCGCGATTTCTCTTTTAG
ATCAGATTATGGAAGAAACGCGCATTCGCCCGGAAGACGAAGAAAGCTATTCCATAGCGCGCAGAGGCGT
AGAGGCGTTTATTTCCGACCTCCTTTCCAGTCAGGAAGTTGATCAACGGATCAATCGCGTTCTGGTCGAT
CGCATGATCTCCGAGTTGGACTTGAAAGTTTCCTCGCAGCTGGACGAAATCCTTCATGATGAGAAGTTTC
AGGAACTTGAGTCTGCCTGGCGCGGACTGAAGCTGCTGGTTGATCGCACAGATTTCCGTGAAAACATCAA
GATCGATGTGCTTTCTGTTTCCAAAGACAAGCTGCTGGAAGATTTTGAAACGAGCCCGGAAGTCGTACAA
TCCGGCCTTTACAAGCACGTCTATTCAAGTGGTTATGGCCAGTTTGGTGGTGAGCCAGTCGGCGCCATGA
TTGCGAACTATGACTTTGGTCCAGGTGCTCGTGATGTAAAACTGCTGCAGTTTGCTGCTTCTGTCGGTGC
AATGGCACACGCTCCATTTATTGCGGCGGCAGGTCCAAAGATGTTCGACGTTGATGAGTATGTGGATCTG
CCAGCGCAGAAAGATCTGTTTTCCATCTACGAAGGACCGCGTTTCCGCAAATGGATGGGCTTCCGACAGA
GTGAAGACTCCCGCTATGTTGGCTTGACATGTCCACGCTTCTTGCTTCGCATGCCGTATGACGCTGAAGA
AAATCCAGTTGATGCGTTCGTCTACAATGAGAACGTGACGGAAGAGCATGAGAGCTACCTTTGGGGTAAT
ACTTCCTTCTTGATGGCGACCCGCCTTACAGAGAGCTTTGCGAAATACCGTTGGTGTCCAAACATCATTG
GCCCTCAATCTGGTGGTGCTGTTCACGATCTTCCAGTGCATGTGTTCGAAGCATTTGGTCAGCTTGAAGA
GAAAATCCCGACAGAAGTTCTGGTCACAGATCGTCGCGAGTTTGAGCTTGCAGAAGAAGGCTTCATTGCG
CTGACCATGCGCAAAGGCTCTGACAATGCCGCTTTCTTCTCCGCAAACTCTGCCCAGAAGCCGAAAATCT
TCCAGAATACGAAGGAAGGTAAAGAAGCGGAGACCAACTACAAACTTGGTACGCAGCTTCCTTACATGAT
GATTGTGAACCGTCTGGCGCACTACATCAAAGTGCTGCAGCGTGAGCAGATTGGGTCCTGGAAAGAACGT
GAAGATCTTGAGCGTGAGCTGAACACCTGGCTGCGCCAGTACGTGGCCGATCAGGAGAACCCACCTCAAG
ATGTGCGTTCACGTCGTCCATTGCGTGCTGCTGAAGTTATCGTCTCCGATGTTGAAGGTGATCCGGGTTG
GTACCAGGTGTCTTTGAAGGTGCGTCCGCACTTCAAGTACATGGGTGCAAACTTTGAGCTGTCGCTCGTA
GGTAAGCTGGACAAGGATAGCTAA