SecReT6
Protein ID: 374330206
SecReT6 ID533
T6SS typei1
Gene symbol-
Locus tagPSE_1858
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1962784..1963182 [+]
ProductType VI secretion system, lysozyme-related protein
NoteTssE
UniProt IDG8PG00
KEGG IDpsf:PSE_1858
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-18, Aligned region: 24..105
Protein Sequence: 132 a.a.     [Download]
>gi|374330206|ref|YP_005080390.1| Type VI secretion system, lysozyme-related protein [Pseudovibrio sp. FO-BEG1]
MFERLIADEEEVAPPQSVDLLEAKVNSIKRHLAKLLNARAGASAATPDLGLVDFNLSSVATNDLTQHIAA
SIRQCIERYEPRVKVRSVHFVRDPDRPLELRFKATLLMPALSKGEQVQIDILMKDGHVAHIV
 
Nucleotide Sequence: 399 bp     [Download]
>gi|374328350|ref|NC_016642.1|:1962784-1963182 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
TTGTTTGAGCGTTTGATTGCTGATGAGGAGGAGGTAGCTCCTCCTCAGAGCGTCGATTTGCTGGAAGCCA
AAGTAAATTCGATCAAACGTCACTTGGCTAAACTGTTGAACGCCAGAGCAGGGGCTTCTGCTGCTACTCC
GGATTTAGGGCTGGTGGACTTCAACCTGTCCAGTGTTGCGACCAACGATCTGACCCAACACATCGCAGCG
TCTATTCGCCAATGCATCGAGAGATACGAACCGCGGGTGAAGGTGCGATCAGTTCATTTTGTCCGTGATC
CCGACAGGCCGTTAGAGCTGCGCTTCAAAGCAACGTTGCTCATGCCCGCCCTTAGCAAGGGAGAGCAGGT
GCAAATCGATATCCTCATGAAAGACGGGCATGTCGCCCACATTGTTTAG