SecReT6
Protein ID: 374330207
SecReT6 ID533
T6SS typei1
Gene symbol-
Locus tagPSE_1859
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1963201..1964988 [+]
ProductType VI secretion system
NoteTssF
UniProt IDG8PG01
KEGG IDpsf:PSE_1859
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-176, Aligned region: 4..595
Protein Sequence: 595 a.a.     [Download]
>gi|374330207|ref|YP_005080391.1| Type VI secretion system [Pseudovibrio sp. FO-BEG1]
MKASYFQDELTYLRESGRLFSERNPRLSKYLSDASTDPDVERLLEGFAFLTSRLREKLDDELPELTHSLV
QLLIPNFLRAFPSTTLMQMVPVEKAITERQVLPAGSQILSKPVDEIVCPFQTTADVTVYPLDIVEQDVQR
SRESTVLTLKFQTLSGLPFSRLSFRDLRLWIAGDEVAAQMLYLWLGRYLKDISVCFESEEAGDDEVTRYK
LPISALQPGSFGGSEALLPNENSAYEGYRLLQEYFVFPAKFQCYDIDGLEPFFRNREETDFSLELTFSRP
LPPEVKVRPGTFRLYCVPAVNLFAYDAEPMKIDHSQMRYPIRPTANGRGAIDIFSIDRIMSWRAAKDPTS
GSHLREYPSFESFHHEVERADGLTQIYYRLRLREALGKRGMEHLVSFVRHDNERAIPEHEVLSADLKCFH
PNHAMELGAGDVCEPTGETPSFVTFKNLGQPTAPVYPPLDGSLYWNLISNLSLNYVSLLEKEALKTVIAT
YDFQARLNRQDERVSKQRIDGIVSIETKPVDKLFRGQAVRGLKTVMSLNEEAFQSEGEMFLFCSVLAEFF
SLYSSVNSFHELIVNGTQNNEVYQWPAKIGRQPLI
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|374328350|ref|NC_016642.1|:1963201-1964988 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
GTGAAAGCTTCTTACTTTCAGGACGAACTGACTTATCTGCGCGAGAGCGGTCGGCTTTTTTCCGAGCGCA
ATCCGCGGCTGTCAAAGTATCTGTCTGACGCCTCCACTGACCCTGATGTGGAACGGTTGCTGGAGGGCTT
TGCGTTCCTGACATCAAGATTGCGCGAGAAGCTGGATGATGAGTTGCCAGAGCTCACCCACTCGCTCGTG
CAGTTGCTTATTCCAAACTTCCTGCGGGCATTTCCTTCAACAACGCTGATGCAGATGGTACCCGTTGAAA
AAGCGATTACAGAACGTCAGGTTCTGCCTGCCGGCTCGCAAATTCTGTCGAAGCCAGTTGATGAGATTGT
TTGTCCGTTTCAAACCACAGCAGATGTAACCGTTTATCCGCTTGATATCGTCGAGCAGGACGTTCAGCGG
TCACGCGAGAGCACAGTCCTGACGCTTAAGTTCCAGACACTCTCTGGTTTGCCGTTTTCTCGACTGAGTT
TCCGCGATCTGCGTTTATGGATTGCAGGAGATGAGGTCGCCGCGCAGATGCTTTATCTGTGGCTGGGGCG
ATATCTGAAGGACATCAGTGTTTGCTTTGAATCCGAAGAGGCAGGGGATGACGAAGTTACCCGCTATAAG
CTTCCGATCTCGGCGTTACAGCCGGGCAGTTTTGGTGGATCTGAGGCACTACTTCCCAATGAAAACTCGG
CCTATGAGGGCTATCGCCTGCTGCAGGAGTACTTCGTCTTTCCTGCGAAGTTCCAATGCTATGATATCGA
TGGACTAGAACCGTTTTTCCGAAATCGCGAAGAGACAGATTTCTCATTAGAGCTCACGTTCTCCAGGCCT
CTGCCACCAGAGGTTAAAGTCCGCCCTGGAACGTTCCGTCTTTACTGCGTGCCAGCAGTGAACCTGTTTG
CCTATGATGCTGAGCCGATGAAGATCGATCATAGCCAAATGCGGTATCCAATCAGGCCAACCGCCAATGG
GCGTGGTGCGATCGATATCTTCTCTATCGACCGCATTATGAGTTGGCGTGCTGCAAAAGATCCGACAAGC
GGGTCTCATTTGCGAGAGTATCCGTCTTTTGAGTCTTTCCATCACGAAGTTGAACGGGCAGATGGCCTAA
CTCAGATTTACTATCGCTTGCGGCTTCGCGAAGCCTTGGGCAAGCGCGGCATGGAACATCTGGTTTCATT
CGTGCGCCATGACAATGAGCGCGCGATCCCGGAGCATGAAGTATTGTCCGCAGACCTGAAGTGCTTCCAT
CCCAACCATGCGATGGAATTGGGAGCAGGGGATGTGTGTGAACCAACCGGTGAAACGCCAAGCTTTGTGA
CCTTCAAGAACTTGGGGCAGCCAACAGCGCCAGTTTATCCGCCACTGGATGGATCGCTCTACTGGAACCT
TATTTCCAATCTTTCTCTCAATTACGTCTCTCTTCTTGAGAAAGAAGCGTTGAAGACCGTGATTGCGACC
TACGATTTTCAGGCGCGCCTGAACCGGCAAGATGAGCGGGTCAGCAAGCAGCGTATTGATGGCATTGTTT
CGATTGAGACAAAGCCAGTCGACAAGCTATTCCGAGGGCAGGCTGTTCGAGGTTTGAAAACAGTCATGTC
CCTCAATGAAGAGGCGTTTCAGAGTGAGGGCGAAATGTTCTTGTTCTGCAGTGTGCTTGCAGAGTTCTTT
TCTCTCTATTCAAGTGTCAATTCGTTCCACGAACTCATCGTAAATGGAACGCAAAATAATGAAGTTTATC
AATGGCCAGCGAAAATTGGGCGACAGCCTCTGATTTAA