SecReT6
Protein ID: 374330208
SecReT6 ID533
T6SS typei1
Gene symbol-
Locus tagPSE_1860
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1964997..1965986 [+]
Producthypothetical protein
NoteTssG
UniProt IDG8PG02
KEGG IDpsf:PSE_1860
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-84, Aligned region: 5..314
Protein Sequence: 329 a.a.     [Download]
>gi|374330208|ref|YP_005080392.1| hypothetical protein PSE_1860 [Pseudovibrio sp. FO-BEG1]
MQFNARSWSFFQAVELIQRCYDESNEVGTHLLPKDEKINFSVMHSLGFPLSDIASIEKRDEAEEGDESIS
YADFNMEVTFLGLHGSSSPLPSYYQEVIAKYDAQGSLMKGFFDFFHNRLVGLLHRSMRKYRFYVRYEPGA
LDPFSQWVFCIFGLSDQEARRKSPINWARLLTFAGVLASRNRSPAAIASVVSHAFFHKDVEVEEWIARKV
DIPAAQRSELGQHNMLLGEDTIIGDSVSDISSKFNIFIKNLSFERFQDFLPHGRDYKALRDLVEFMLRDQ
HAYDIKLELAPKQAAPVVLSDEYQGRLGWSTFLDKGDESPREVLISARL
 
Nucleotide Sequence: 990 bp     [Download]
>gi|374328350|ref|NC_016642.1|:1964997-1965986 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGCAGTTTAATGCTCGCAGCTGGTCCTTCTTCCAAGCTGTTGAGTTGATCCAGCGTTGCTATGACGAAA
GCAATGAGGTTGGTACGCATCTTTTGCCAAAAGATGAGAAGATCAACTTCAGTGTTATGCATTCTCTCGG
CTTTCCGCTCTCTGATATTGCCAGTATCGAGAAACGAGATGAGGCAGAAGAAGGTGACGAGTCGATCAGT
TATGCTGACTTCAATATGGAAGTCACATTCCTTGGCTTGCATGGTTCAAGTTCGCCGCTTCCCTCTTACT
ATCAAGAGGTCATAGCCAAGTATGATGCGCAGGGCTCCTTGATGAAGGGGTTCTTTGATTTCTTCCATAA
TCGCCTTGTTGGCCTCTTGCACCGTTCCATGCGCAAGTATCGCTTTTACGTGCGTTATGAACCTGGGGCG
TTGGATCCGTTCTCTCAATGGGTGTTCTGCATCTTCGGGCTTTCAGATCAGGAAGCTCGTCGCAAATCCC
CGATCAATTGGGCGCGCTTGCTTACATTTGCAGGTGTGTTGGCCTCCCGCAATCGCTCACCGGCTGCCAT
TGCCAGTGTCGTCTCACATGCCTTTTTTCATAAGGATGTTGAAGTGGAAGAGTGGATCGCTCGTAAGGTG
GACATTCCTGCTGCTCAACGCTCTGAACTTGGACAGCACAATATGCTTCTGGGTGAAGACACCATTATCG
GGGACAGCGTTTCCGATATCTCCAGTAAGTTCAATATCTTCATCAAGAACCTGAGTTTCGAGCGCTTTCA
GGACTTTCTCCCGCATGGGCGTGACTACAAGGCCCTACGAGATCTGGTGGAGTTCATGCTGCGCGACCAG
CATGCCTACGACATCAAACTGGAACTCGCGCCCAAACAGGCCGCACCTGTTGTGCTTTCCGATGAATATC
AAGGACGGCTGGGTTGGTCGACGTTTCTCGACAAAGGGGATGAGAGCCCTCGCGAAGTTCTCATTTCAGC
GCGGTTGTAG