SecReT6
Protein ID: 374330209
SecReT6 ID533
T6SS typei1
Gene symbolfha
Locus tagPSE_1861
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1965995..1967494 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDG8PG03
KEGG IDpsf:PSE_1861
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.10E-08, Aligned region: 29..96
Protein Sequence: 499 a.a.     [Download]
>gi|374330209|ref|YP_005080393.1| FHA domain-containing protein [Pseudovibrio sp. FO-BEG1]
MKLVLVINNTSTLENGSKATATFEKTGGSIGSGAQCHWQLMDRHNSVSREHVRVFFQDGVYCAEAVGDEG
IIVNGSNRPIPSGQRFRISDGDVWKVGAFKLTTYVVAEGSELEDHSEQWAGRFAAIDTIVSGHLQDEDEQ
SQSNIEYILADRLESDLSEDFFASNQRSNALLCDPVEVLDQQDEEGLPGNQDPLFQLNHDSEPEQQEQDE
DLLGTLGLQPEYSGKAVGIDDPQAHHRLMIMPQAKGNHAMSTTSTEPVDPEMDSYLESLTNSGGQEMLVS
DIQETESWHGSVSLSETGEEGMVDHVVLRPLLSALGLPIGDMSLPEANRITQEVGAALKTAISGLMSIHA
QQWEDRSSMNDTHLHPVEDNPIRLAQSPEQAIEDLLLVQSPVHLNAPSAIEESLMQIELHEKASRIAADE
ALEAVLFGLSPENLTKRFARYKGHAPRTGDLDSWNWQMYEHYYNEMRSGRQRGLTRMFWEIFRQVYDREM
RSHQLCAAE
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|374328350|ref|NC_016642.1|:1965995-1967494 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGAAGCTGGTTTTAGTCATCAACAACACCTCCACGTTAGAGAACGGCAGCAAAGCCACCGCTACGTTTG
AGAAAACCGGCGGAAGTATCGGTTCTGGAGCGCAGTGCCATTGGCAGCTGATGGATAGGCACAACTCCGT
CTCCCGTGAACATGTGCGCGTGTTCTTTCAGGATGGCGTCTATTGCGCAGAAGCCGTTGGTGATGAAGGG
ATCATCGTAAACGGTTCAAACCGGCCAATTCCGTCCGGGCAACGCTTTCGCATTTCAGATGGTGATGTCT
GGAAGGTTGGGGCGTTTAAACTGACAACCTATGTGGTCGCTGAAGGAAGCGAACTGGAGGACCACAGCGA
GCAGTGGGCGGGCCGGTTTGCAGCTATTGATACCATCGTGTCAGGGCATTTGCAGGATGAAGACGAACAG
TCTCAAAGCAACATTGAATACATCTTGGCTGATCGCCTTGAGAGCGATCTGAGCGAAGACTTTTTTGCGA
GCAATCAACGCTCCAACGCGCTTCTTTGTGATCCGGTTGAAGTTCTTGACCAGCAAGATGAAGAAGGCCT
GCCGGGAAATCAGGACCCTCTCTTCCAACTCAATCACGACAGTGAGCCGGAACAGCAAGAGCAGGATGAA
GATCTTCTGGGCACGCTGGGATTGCAACCCGAATACAGCGGGAAGGCGGTGGGTATCGATGACCCTCAAG
CGCATCACCGCCTCATGATTATGCCCCAAGCAAAAGGAAACCACGCAATGTCCACGACGAGTACAGAGCC
GGTTGACCCGGAAATGGATAGCTATCTTGAATCCCTGACGAACTCGGGCGGGCAGGAAATGCTGGTCAGT
GATATTCAGGAGACCGAGAGTTGGCATGGGTCGGTTTCTTTATCTGAAACGGGCGAAGAAGGCATGGTGG
ATCACGTAGTGCTGCGTCCACTCCTTTCAGCATTGGGACTACCGATTGGCGATATGAGTTTGCCTGAGGC
AAACCGCATTACCCAAGAAGTTGGTGCGGCTTTGAAGACTGCGATTTCCGGTCTGATGTCCATTCACGCT
CAGCAGTGGGAAGATCGGTCTTCCATGAACGACACCCATTTGCATCCGGTGGAAGACAACCCAATCCGAC
TGGCGCAAAGCCCTGAACAGGCAATTGAAGATTTGCTGCTTGTTCAAAGCCCTGTGCACCTGAATGCACC
ATCCGCCATTGAAGAGAGCCTCATGCAAATTGAGTTGCATGAGAAGGCAAGCCGTATCGCTGCTGACGAA
GCTTTGGAAGCGGTTCTGTTTGGTCTCTCTCCTGAGAACCTGACCAAACGCTTTGCGCGTTACAAAGGGC
ATGCGCCTCGTACAGGGGACCTCGATAGCTGGAACTGGCAGATGTACGAGCACTACTACAATGAAATGCG
TTCGGGTCGACAGCGCGGACTAACCCGCATGTTTTGGGAGATCTTCCGACAGGTTTACGACCGTGAGATG
CGCAGCCATCAGCTCTGTGCTGCGGAGTAA