SecReT6
Protein ID: 374330210
SecReT6 ID533
T6SS typei1
Gene symbol-
Locus tagPSE_1862
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1967560..1968120 [+]
Producthypothetical protein
NoteTssJ
UniProt IDG8PG04
KEGG IDpsf:PSE_1862
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.80E-31, Aligned region: 25..180
Protein Sequence: 186 a.a.     [Download]
>gi|374330210|ref|YP_005080394.1| hypothetical protein PSE_1862 [Pseudovibrio sp. FO-BEG1]
MNWGWTQHALLKKSFHLVCMVAALLVLGACEAQKIPEKVFKVVMDPGIPVGEPKDQPSLIDVTIFSEPGS
NKNDLGESVPIDVWVFQLGDDGKLLQSSFEEATEDYENALGTTFVDVKEVQVMPGESKVVTELELDKETV
FIGLVGGYAKPEKVDWRAVEKVKPKGETYKLLAVISRKKIITNLHR
 
Nucleotide Sequence: 561 bp     [Download]
>gi|374328350|ref|NC_016642.1|:1967560-1968120 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGAACTGGGGTTGGACACAACACGCGCTCCTGAAAAAGAGCTTCCACTTGGTCTGCATGGTCGCAGCAC
TGCTGGTGCTGGGCGCATGCGAAGCGCAGAAGATACCTGAGAAGGTTTTCAAAGTGGTTATGGATCCGGG
CATTCCAGTGGGAGAGCCCAAAGACCAGCCGAGCTTGATTGATGTCACCATTTTCTCTGAACCGGGATCA
AACAAGAACGATCTTGGTGAGAGTGTTCCCATTGATGTCTGGGTCTTTCAGCTGGGTGATGACGGTAAGT
TGCTTCAATCCTCGTTTGAGGAGGCGACGGAAGACTATGAGAACGCTCTTGGAACCACCTTTGTTGACGT
GAAAGAGGTTCAGGTCATGCCTGGGGAGTCAAAGGTTGTGACAGAACTGGAGCTGGACAAGGAAACGGTC
TTTATCGGTCTGGTTGGCGGATATGCCAAGCCTGAGAAGGTCGACTGGCGTGCTGTTGAGAAGGTCAAGC
CCAAGGGAGAGACGTACAAGCTACTTGCTGTGATCAGCAGAAAAAAAATTATCACAAACCTGCATCGATA
G