SecReT6
Protein ID: 374330211
SecReT6 ID533
T6SS typei1
Gene symbol-
Locus tagPSE_1863
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1968228..1969499 [+]
Producthypothetical protein
NoteTssK
UniProt IDG8PG05
KEGG IDpsf:PSE_1863
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-135, Aligned region: 2..418
Protein Sequence: 423 a.a.     [Download]
>gi|374330211|ref|YP_005080395.1| hypothetical protein PSE_1863 [Pseudovibrio sp. FO-BEG1]
MEHLIRSRSEAIDPYQHGVSRLEINKESLLHGKLLVDYVLGIFPDGTTIDVPGESMAPAPLDVSGENVVG
QTVYLALPLRSNGVPEVEDPLNPQDATRMRAFSQDVRNNTSSDTEPFMVDVAQYRLRLMLEREDRSAFTC
LPLTRIRNKNSDGSVVLDDEFLPMASTIDAQPRLRKTLDDLVGLLRQRATHISTRMGTPGQRGVSDVSDF
LMLQTINRLWPEFRHTSSLKGVHPRELYKIFSGAAGELATFTNEQRMPTSWPAYHHEEPQVCFDPVISSL
RQSLSTIFEANAIALPLNKQKYGIITSPLNDRSLLNSAIFVVAVKASMELEELAKSFPAQTKVSSIERIR
ELIHLHLPGVVLQRLPSPPRQLPYHAGFSYFQLDANSAGWQYIENASGFAFHIAGEFADLQLQFWAIRNE
RTA
 
Nucleotide Sequence: 1272 bp     [Download]
>gi|374328350|ref|NC_016642.1|:1968228-1969499 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
TTGGAGCATCTTATCCGCTCTCGCAGCGAAGCTATTGATCCTTACCAGCATGGGGTGAGCCGGTTGGAGA
TCAATAAGGAAAGTCTTCTGCATGGCAAGCTGCTCGTTGATTATGTGCTCGGCATTTTCCCCGATGGCAC
GACAATTGATGTGCCCGGCGAGTCCATGGCACCTGCACCTTTGGATGTGAGCGGTGAAAATGTCGTGGGT
CAGACCGTTTATCTGGCTTTGCCACTGCGCTCAAATGGCGTGCCGGAGGTCGAAGATCCGCTTAATCCTC
AGGATGCGACCAGAATGCGCGCCTTCTCTCAGGATGTGCGCAACAACACCAGCTCAGACACAGAACCTTT
CATGGTGGATGTGGCACAGTATCGTTTACGCCTGATGCTGGAACGCGAAGATCGCTCTGCTTTCACTTGC
TTGCCGCTGACACGCATTAGGAACAAAAACTCGGATGGCAGCGTTGTGCTGGATGACGAGTTCCTGCCAA
TGGCCTCGACTATCGATGCTCAGCCGCGTTTGCGCAAAACGCTTGATGATCTGGTGGGATTACTGCGTCA
AAGAGCAACGCACATTTCAACGCGTATGGGGACGCCCGGTCAAAGGGGGGTCTCGGATGTCTCCGATTTT
CTTATGCTGCAAACGATCAACCGGCTCTGGCCTGAATTTCGGCATACATCATCGCTTAAAGGCGTGCACC
CAAGAGAGCTTTACAAGATCTTTTCTGGTGCAGCAGGAGAACTGGCGACGTTCACCAATGAGCAGCGGAT
GCCTACGTCCTGGCCTGCGTATCATCATGAAGAGCCGCAGGTTTGCTTCGATCCGGTGATTAGTTCATTG
CGCCAATCACTGTCGACGATCTTTGAAGCGAACGCGATTGCGCTGCCGTTGAACAAACAGAAGTACGGGA
TCATTACCTCTCCGCTCAATGATCGCTCACTGTTGAACTCAGCAATCTTCGTGGTTGCTGTGAAAGCAAG
CATGGAGCTTGAAGAGCTGGCAAAATCCTTCCCGGCACAAACCAAGGTCTCTTCCATTGAGCGTATTCGT
GAGCTGATCCATCTGCATTTGCCGGGTGTGGTTCTGCAGCGGTTGCCGTCTCCTCCGCGGCAGCTGCCTT
ATCATGCCGGGTTCTCATACTTCCAGTTGGATGCCAACTCAGCAGGCTGGCAATACATTGAAAACGCGAG
TGGTTTTGCATTCCACATTGCGGGCGAGTTTGCTGATCTACAGCTGCAGTTCTGGGCTATTCGCAATGAA
AGGACGGCATGA