SecReT6
Protein ID: 374330212
SecReT6 ID533
T6SS typei1
Gene symboldotU
Locus tagPSE_1864
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1969496..1970317 [+]
ProductType IV / VI secretion system DotU
NoteTssL
UniProt IDG8PG06
KEGG IDpsf:PSE_1864
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-57, Aligned region: 53..257
Protein Sequence: 273 a.a.     [Download]
>gi|374330212|ref|YP_005080396.1| Type IV / VI secretion system DotU [Pseudovibrio sp. FO-BEG1]
MMSEVANLFDASDPEVAEDVPVATAESVPQNLKDVSPRPVQHISFPMRGHSINKIIDASQSLLALISRIP
EVSENNKLDYLHKDVRAEIESLELELQREGFDRATILAHRYCLCSAIDEAVMCSPWGQNSDWSERSLLAL
FHSETWGGEKFFIVLSRLMRDPVRYIELIEFLYVLLGLGFEGKYRVMHNGKLQLEEIMRDVRHIIRQERG
EGTSELGQSENKIIEKAHVVHWHTPVSLVWISLFILCALTYVGFYWQIDQYTDGVVTQLREML
 
Nucleotide Sequence: 822 bp     [Download]
>gi|374328350|ref|NC_016642.1|:1969496-1970317 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGATGAGTGAAGTCGCAAATCTGTTTGACGCTAGCGATCCTGAAGTTGCAGAGGATGTGCCTGTCGCAA
CAGCAGAAAGCGTTCCGCAGAACCTGAAAGATGTTTCTCCGAGACCTGTTCAACACATCAGCTTTCCGAT
GCGGGGGCACAGCATCAATAAGATCATTGATGCGAGCCAATCATTGTTGGCTTTGATCTCGCGTATCCCG
GAAGTCTCAGAAAACAACAAACTGGATTACCTCCATAAGGATGTTCGGGCAGAGATTGAATCTCTGGAAC
TTGAACTCCAGCGCGAAGGGTTTGACCGGGCGACTATTCTGGCTCACCGCTATTGCCTTTGCTCTGCAAT
TGATGAGGCGGTGATGTGCTCTCCCTGGGGGCAGAATTCTGACTGGTCAGAGCGCAGCCTGTTGGCTCTA
TTTCATAGCGAGACCTGGGGTGGAGAAAAGTTCTTCATCGTTCTTAGCAGGTTGATGCGAGATCCGGTTC
GATACATCGAGTTGATTGAGTTCTTGTATGTGCTGCTTGGCCTCGGTTTTGAGGGCAAATACCGGGTCAT
GCACAACGGCAAGCTGCAGCTTGAGGAAATTATGCGGGACGTTCGCCACATCATCCGTCAGGAACGCGGT
GAGGGGACTTCTGAACTCGGTCAATCAGAAAACAAAATCATAGAAAAAGCGCATGTTGTTCATTGGCATA
CGCCTGTTTCCCTAGTTTGGATTAGCCTTTTTATTTTGTGCGCACTGACCTACGTCGGGTTTTATTGGCA
GATCGACCAATACACCGACGGCGTTGTCACTCAACTGCGCGAAATGCTATAG