SecReT6
Protein ID: 374330213
SecReT6 ID533
T6SS typei1
Gene symbolclpV1
Locus tagPSE_1865
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1970333..1973032 [+]
ProductATPase, type VI secretion system ClpV1
NoteTssH
UniProt IDG8PG07
KEGG IDpsf:PSE_1865
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-35, Aligned region: 222..242
AAA_2 [PF07724], Evalue: 1.40E-35, Aligned region: 610..776
AAA [PF00004], Evalue: 2.50E-18, Aligned region: 223..353
AAA [PF00004], Evalue: 2.50E-18, Aligned region: 615..739
AAA_5 [PF07728], Evalue: 1.30E-12, Aligned region: 224..246
AAA_5 [PF07728], Evalue: 1.30E-12, Aligned region: 614..740
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 454..517
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 602..650
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 680..708
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 783..813
ClpB_D2-small [PF10431], Evalue: 9.20E-11, Aligned region: 467..491
ClpB_D2-small [PF10431], Evalue: 9.20E-11, Aligned region: 784..857
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 221..318
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 460..472
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 613..635
Clp_N [PF02861], Evalue: 2.50E-06, Aligned region: 24..71
AAA_25 [PF13481], Evalue: 3.40E-05, Aligned region: 223..246
AAA_25 [PF13481], Evalue: 3.40E-05, Aligned region: 612..646
Arch_ATPase [PF01637], Evalue: 8.30E-05, Aligned region: 201..235
Arch_ATPase [PF01637], Evalue: 8.30E-05, Aligned region: 274..307
Arch_ATPase [PF01637], Evalue: 8.30E-05, Aligned region: 612..653
Arch_ATPase [PF01637], Evalue: 8.30E-05, Aligned region: 680..696
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 224..247
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 495..529
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 615..710
NACHT [PF05729], Evalue: 0.00015, Aligned region: 223..250
NACHT [PF05729], Evalue: 0.00015, Aligned region: 614..628
AAA_19 [PF13245], Evalue: 0.00022, Aligned region: 219..244
AAA_19 [PF13245], Evalue: 0.00022, Aligned region: 612..636
Sigma54_activat [PF00158], Evalue: 0.00045, Aligned region: 219..283
Sigma54_activat [PF00158], Evalue: 0.00045, Aligned region: 615..712
IstB_IS21 [PF01695], Evalue: 0.00054, Aligned region: 205..245
IstB_IS21 [PF01695], Evalue: 0.00054, Aligned region: 615..628
Zeta_toxin [PF06414], Evalue: 0.00062, Aligned region: 68..94
Zeta_toxin [PF06414], Evalue: 0.00062, Aligned region: 222..242
Zeta_toxin [PF06414], Evalue: 0.00062, Aligned region: 613..654
AAA_17 [PF13207], Evalue: 0.00065, Aligned region: 224..242
AAA_17 [PF13207], Evalue: 0.00065, Aligned region: 463..479
AAA_17 [PF13207], Evalue: 0.00065, Aligned region: 614..649
AAA_14 [PF13173], Evalue: 0.001, Aligned region: 225..325
AAA_14 [PF13173], Evalue: 0.001, Aligned region: 613..696
NB-ARC [PF00931], Evalue: 0.0081, Aligned region: 202..236
NB-ARC [PF00931], Evalue: 0.0081, Aligned region: 604..634
Protein Sequence: 899 a.a.     [Download]
>gi|374330213|ref|YP_005080397.1| ATPase, type VI secretion system ClpV1 [Pseudovibrio sp. FO-BEG1]
MARLEIKALIERLNPCCRQAIEEAASLCVSNSHQEVTIEHFLISLASQPAVDFRLLVQSQNVDVDVLNEA
FRATFNRYRRVEADRTPTFSPLLQDLLQDAWLIASVEQGEKTVRSGAVLIALLNDRGRYMQMDYYPLLER
VSSDTLLRQFDELTAGSFEKDHRAGQGAAASAGDTADGFLHKYGTNFTQLAKDGKIDPIFCRDNEIRQII
EILCRRRKNNPICVGEAGVGKTALAEGLALRIANGEVPEDFANVALWGLDVGALQAGASMKGEFEKRLKG
VIDEVRSSAEPIILFIDEAHTLIGAGGDQGGSDAANLLKPALARGELKTIAATTWTEYKKYFEKDPALTR
RFQLVKLDEPTIDEAIIIMRGLKKAYEEAHGVYITEEAIGASVRLAARYITGRQLPDKAIDVLDTACARV
RAGANTPPVELQDVEQSLQTLSWEREGLERDQLTAPLEPEQLERLKAIADQINDLEERKQELSSRLEAQV
ALAENFISAREDLFQKQPETLEEDTLEQGRALLANHKNVLIVEAGSEPLISVEVGSAEIAAIISDWTGIP
VNSMVQDDYHRLLTLAETMKKAIKGQDHAIDAIEARLRASRLDLHKKGQPLGVFFLAGPSGVGKTETALE
VSRRLFGGEEFITTINMSEYQERHTVSRLIGSPPGYVGYGEGGVLTEAIRKKPYSVVLLDEVEKADPNVL
NLFYQAFDKGELADGEGRLIDCRNVVFFLTSNLGSDQIENWVANAEDDQVPSHGSMLKSLTPLFAQHFKP
ALLARMEPLVYMPLSEEVLADIVQMRLDDLIELLKETQKIALTITEAAYGRVTQMCRVASNGARLVDQVI
QRQLLPTLSIEILEAGHRGEHIASITIDSPEDDGGFSFSAVFQEDAIAEPTDENILEEA
 
Nucleotide Sequence: 2700 bp     [Download]
>gi|374328350|ref|NC_016642.1|:1970333-1973032 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGGCTCGACTGGAAATCAAGGCGCTGATTGAGCGTCTAAACCCGTGCTGTCGGCAGGCAATTGAAGAAG
CTGCTAGCCTGTGCGTTTCAAACTCGCATCAGGAAGTAACAATTGAGCATTTCCTCATTTCTCTTGCTTC
ACAACCTGCAGTAGATTTTAGGCTTCTCGTACAAAGCCAGAATGTAGATGTCGACGTTTTGAACGAAGCA
TTTCGTGCGACGTTCAATCGGTATCGTCGGGTTGAAGCCGACCGGACACCAACCTTCTCGCCGCTGCTTC
AGGATTTACTGCAGGATGCCTGGCTAATCGCTTCCGTCGAACAAGGTGAAAAGACCGTTCGCTCAGGGGC
AGTGCTGATTGCACTGCTGAATGATCGCGGTCGTTACATGCAGATGGATTACTATCCGCTGCTTGAGCGC
GTATCCTCCGACACTTTGCTCCGGCAGTTTGATGAGCTAACTGCGGGGTCATTTGAGAAGGACCATCGTG
CCGGGCAGGGTGCTGCTGCAAGTGCAGGCGATACGGCGGATGGATTTCTTCATAAATACGGAACCAACTT
CACTCAGCTTGCGAAGGATGGAAAGATTGACCCAATCTTCTGCCGGGACAATGAGATCCGCCAGATTATT
GAGATCCTGTGTCGCCGTCGCAAAAATAATCCGATTTGTGTTGGCGAAGCAGGCGTAGGTAAAACCGCAC
TCGCTGAAGGGCTTGCACTGCGCATTGCAAATGGCGAGGTGCCTGAAGACTTTGCCAATGTCGCGCTATG
GGGGCTGGATGTAGGTGCCCTGCAAGCGGGCGCTTCCATGAAAGGCGAGTTTGAAAAGCGCTTGAAGGGC
GTGATCGATGAAGTGCGGTCCAGCGCTGAGCCGATCATTCTGTTCATCGATGAAGCCCATACTCTGATTG
GGGCAGGGGGCGACCAAGGTGGTTCTGATGCCGCGAACCTTTTGAAACCAGCCCTTGCCAGAGGTGAGCT
GAAAACAATCGCTGCAACAACCTGGACGGAGTACAAAAAGTACTTCGAAAAAGACCCTGCACTCACTCGC
CGCTTCCAGTTGGTGAAGCTGGATGAGCCGACCATTGATGAGGCTATCATCATCATGCGCGGGCTCAAAA
AGGCCTATGAAGAAGCGCATGGCGTTTACATCACTGAAGAAGCTATTGGCGCTTCTGTTCGGCTGGCTGC
GCGTTACATCACCGGTCGCCAACTGCCGGACAAAGCGATTGATGTTTTGGATACAGCCTGTGCCCGTGTG
CGCGCTGGAGCCAACACTCCCCCAGTAGAACTGCAGGATGTGGAGCAAAGCCTTCAAACCCTGAGCTGGG
AGAGGGAAGGCCTGGAGCGCGATCAGCTCACGGCACCTTTAGAGCCTGAGCAACTGGAGCGTCTGAAGGC
AATTGCGGATCAGATCAATGATCTTGAAGAACGCAAGCAGGAACTATCATCTCGCCTTGAAGCGCAGGTG
GCGCTGGCTGAAAACTTTATCTCTGCGCGTGAAGACTTGTTCCAAAAACAGCCGGAAACGCTGGAAGAAG
ATACACTGGAGCAAGGCCGCGCTCTGCTCGCCAATCACAAAAATGTGCTGATAGTGGAAGCCGGTTCTGA
GCCTCTCATTTCAGTCGAAGTGGGCTCTGCGGAAATTGCTGCCATTATAAGCGATTGGACGGGCATTCCG
GTCAACTCCATGGTTCAGGATGATTACCATCGCCTTCTGACACTTGCCGAAACCATGAAGAAGGCTATCA
AAGGACAGGACCACGCGATTGATGCCATCGAAGCGCGGTTGCGTGCATCACGGCTTGATCTGCATAAAAA
AGGTCAGCCGTTGGGCGTGTTCTTCCTTGCTGGACCTTCAGGCGTCGGTAAAACAGAAACTGCTCTGGAA
GTATCGCGCCGGTTGTTCGGTGGCGAGGAGTTCATCACGACCATCAATATGTCTGAGTATCAGGAGCGAC
ATACAGTCTCTCGTCTGATTGGTTCGCCTCCCGGTTATGTCGGTTATGGCGAGGGTGGCGTTCTGACGGA
AGCCATTCGCAAGAAGCCATACTCAGTCGTGCTGCTTGATGAAGTTGAAAAGGCTGACCCCAACGTCCTT
AATTTGTTTTATCAGGCCTTTGACAAAGGAGAACTGGCAGACGGGGAAGGCCGCCTCATAGATTGTCGCA
ATGTGGTGTTCTTCCTGACCAGCAATCTGGGCTCAGATCAGATTGAGAACTGGGTTGCAAATGCAGAAGA
CGATCAGGTGCCGAGCCACGGTTCAATGCTGAAGTCTCTTACTCCGCTGTTTGCTCAACATTTCAAACCA
GCGCTTTTGGCCCGCATGGAACCTCTGGTGTACATGCCGCTTTCTGAAGAAGTGCTGGCCGACATTGTTC
AGATGCGTCTGGATGATCTTATTGAGCTGCTGAAAGAAACCCAAAAGATAGCTCTCACAATCACCGAGGC
TGCATATGGCCGCGTGACGCAAATGTGCCGGGTGGCCTCAAACGGTGCGCGACTTGTTGATCAGGTTATC
CAGCGCCAGTTGCTCCCCACTCTCTCCATTGAGATCCTGGAGGCGGGGCATCGCGGCGAGCACATCGCTT
CCATCACCATCGACTCTCCAGAAGACGATGGCGGTTTCTCTTTTTCTGCGGTTTTCCAGGAAGATGCGAT
TGCTGAACCAACCGATGAAAACATATTGGAAGAGGCATAG