SecReT6
Protein ID: 374331191
SecReT6 ID534
T6SS typei3
Gene symboldotU
Locus tagPSE_2845
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3038856..3040196 [-]
ProductType IV / VI secretion system, DotU/OmpA/MotB
NoteTssL
UniProt IDG8PRZ7
KEGG IDpsf:PSE_2845
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-62, Aligned region: 32..237
OmpA [PF00691], Evalue: 8.50E-13, Aligned region: 332..430
Protein Sequence: 446 a.a.     [Download]
>gi|374331191|ref|YP_005081375.1| Type IV / VI secretion system, DotU/OmpA/MotB [Pseudovibrio sp. FO-BEG1]
MEPGATNLPAQTPAGYWFLGADDIQFVPLGNNALVKAASSLLALAARLRNHAQHRDVNALRSHVISEIRA
FEHNSMLGGLSSKTIRIARYVLCATLDDIILNTPWGSRSIWATQSLVSNFHKDVSGGDRFYDLLRKTQAN
PSRDKDLLELLYLCISLGFEGRLRIMPQGTNTMSRLRYGISRLIRSLRGDQETDLSPHWRGVEDAYRPLK
WSIPVWGIFFGAAVLGLLIYGILLFWLGEKSERIAFQYESLINTSPIDLTHQPAPPRAALPNLPQQQATP
GTPGSPSSPQVVRSSTAYQQISAFLATEIQQGLVVVMNANGNVVIRLTGSGMFATARDTLTARFIPVVNR
VAEALNTRPGRINVVGYSDNIPIRNAQFRNNVALSKARAQTVADLIKVRLSDKNRVRAIGRGSADPIASN
ATAEGRAQNRRIDITLIPSTGQGGQQ
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3040196-3038856 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGGAGCCGGGTGCCACCAATCTTCCGGCTCAAACCCCTGCAGGCTACTGGTTCCTCGGGGCGGATGACA
TTCAGTTCGTGCCCCTTGGTAACAATGCGCTCGTGAAAGCCGCAAGCAGCTTGCTTGCGCTTGCCGCACG
CTTGCGGAACCATGCGCAGCACCGGGATGTAAATGCTCTTCGGTCTCACGTTATCTCTGAAATCCGCGCT
TTTGAGCACAACTCGATGCTGGGTGGCCTCTCGTCCAAGACCATTCGCATTGCACGCTATGTTCTCTGTG
CCACGCTTGATGACATCATTCTCAACACCCCCTGGGGGAGCCGCAGTATCTGGGCAACTCAGAGCCTTGT
GAGCAATTTCCATAAGGACGTGTCCGGTGGTGACAGATTTTATGATCTATTGAGGAAGACGCAGGCCAAT
CCAAGTCGTGACAAAGATCTTCTGGAGTTGTTGTATCTTTGTATTTCACTCGGGTTTGAAGGTCGCTTGC
GGATCATGCCGCAAGGCACCAACACCATGTCGCGGCTGCGCTATGGTATCTCTCGCCTCATTCGCTCCTT
ACGTGGAGATCAGGAAACTGACCTTTCCCCCCATTGGCGCGGTGTTGAGGATGCCTACAGGCCGCTGAAG
TGGTCTATTCCGGTCTGGGGGATCTTCTTCGGTGCTGCTGTGCTCGGACTGCTGATTTACGGCATATTGC
TGTTCTGGCTTGGTGAGAAGAGTGAGCGTATTGCATTTCAGTATGAATCCCTCATCAACACCAGTCCAAT
CGATCTGACGCATCAACCGGCACCACCACGCGCAGCATTGCCTAACCTGCCTCAGCAGCAGGCTACTCCG
GGCACACCGGGTAGTCCTTCATCACCACAGGTTGTTCGCAGTTCAACGGCGTATCAGCAAATCAGTGCCT
TCCTTGCCACTGAAATCCAGCAAGGCCTCGTGGTTGTGATGAATGCCAATGGGAATGTTGTTATCCGTCT
GACCGGTTCAGGTATGTTTGCGACAGCACGCGATACGTTGACAGCCCGGTTTATTCCAGTTGTGAACCGT
GTGGCTGAGGCGCTCAACACACGTCCGGGCAGGATCAATGTGGTTGGATACTCTGACAACATTCCGATCC
GAAATGCCCAATTCAGAAACAATGTGGCGCTTTCCAAAGCTCGCGCGCAGACTGTGGCTGATCTGATCAA
GGTTCGTCTGTCTGACAAGAACCGTGTAAGGGCCATTGGCAGAGGTTCTGCTGACCCTATTGCTTCCAAT
GCAACGGCTGAAGGGCGTGCGCAGAACAGGCGCATTGATATTACGCTGATCCCTAGCACTGGCCAGGGAG
GTCAGCAATGA