SecReT6
Protein ID: 374331192
SecReT6 ID534
T6SS typei3
Gene symbol-
Locus tagPSE_2846
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3040306..3041643 [-]
Producthypothetical protein
NoteTssK
UniProt IDG8PRZ8
KEGG IDpsf:PSE_2846
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-153, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|374331192|ref|YP_005081376.1| hypothetical protein PSE_2846 [Pseudovibrio sp. FO-BEG1]
MTTHNKVVWSEGLFLQPQHFQQHDRYLEQLVSDSISSIRPHPWGHTELKINQEALKLGQFALNFASGVMP
DGTPFKMPQECDAPASIPVPESVKNSVIYLALPIRQPGAYEYEYPGVQETAARYVVHESEARDAITGSDA
SVQMETGRLRFTFKFDFEDLDGWICLPIARVIEVRADKQVILDDEYISTCLAAHSSSVLYGYIREIWGML
SHRADALAGRVSNSGSKGVAEISDFLLLQTVNRYEPLYAHFAQTPSLHPEALYRISIQLVGELATFTAAA
RRPSTLQPYRHEALTESFAPVIAHLRQHLSAVLEQTAVPIPLEERKYGVRVGMLLDRSLIKSARFVLAVS
ADLPSEVINRHFPGQITIGSVEQIRDFVNSALAGIAVKQLPVAPRQIPYHTGTAYFELDPASSHWDEIRV
SGGLALHVAGDFPKLVMELWAIREQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3041643-3040306 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGACCACTCATAACAAAGTTGTCTGGTCAGAAGGCCTGTTTCTACAGCCGCAGCATTTTCAGCAGCATG
ATCGCTATCTGGAACAGCTGGTCAGTGACAGTATCTCGAGCATTCGCCCTCACCCATGGGGGCATACAGA
GCTGAAAATCAATCAGGAAGCTCTGAAACTAGGACAATTCGCGCTCAATTTTGCCAGCGGCGTCATGCCG
GATGGAACACCCTTCAAGATGCCACAGGAATGTGACGCTCCTGCGTCCATCCCAGTGCCTGAGAGCGTTA
AAAACTCTGTCATCTATTTAGCTCTGCCCATTCGGCAACCCGGCGCTTATGAGTACGAGTATCCAGGCGT
TCAGGAAACTGCAGCGCGTTATGTGGTGCATGAATCTGAAGCGCGGGATGCCATTACTGGCAGTGATGCC
AGCGTGCAGATGGAAACCGGACGTCTGCGTTTTACTTTCAAGTTTGACTTTGAGGATCTGGATGGCTGGA
TCTGCCTGCCTATTGCACGTGTGATTGAGGTGCGGGCTGATAAGCAAGTGATCTTGGATGACGAGTACAT
CTCCACTTGCCTTGCCGCACATTCCTCTTCAGTGCTTTACGGCTATATTCGCGAAATCTGGGGCATGCTG
AGTCACCGTGCAGATGCTTTGGCGGGCCGTGTCTCCAACTCTGGCAGCAAGGGTGTTGCAGAGATTTCTG
ACTTCCTGCTTTTGCAGACGGTCAATCGATACGAGCCACTTTACGCACACTTTGCTCAGACGCCCTCCCT
TCATCCGGAAGCGCTCTATCGCATCTCCATTCAGCTGGTGGGTGAACTGGCGACATTTACAGCGGCGGCA
CGGCGACCCTCGACGCTTCAACCCTACCGCCATGAGGCTCTGACAGAGTCTTTTGCGCCGGTTATTGCCC
ATTTGAGGCAGCATCTTTCAGCGGTTCTGGAGCAGACAGCTGTTCCGATCCCACTGGAGGAGCGCAAGTA
CGGTGTGCGGGTTGGTATGTTGCTCGACCGCAGCCTGATCAAGTCAGCGCGCTTTGTTCTTGCTGTTAGT
GCTGATCTGCCATCTGAGGTGATCAATCGTCACTTCCCAGGTCAGATCACGATCGGCTCAGTGGAGCAAA
TCCGCGACTTTGTGAACTCGGCGCTGGCAGGCATTGCGGTGAAGCAGTTGCCGGTTGCGCCACGACAGAT
CCCGTATCACACGGGCACAGCATATTTCGAACTGGATCCGGCCTCATCACATTGGGACGAAATCCGCGTT
TCAGGCGGCCTTGCGCTGCATGTTGCGGGCGACTTCCCGAAACTTGTGATGGAACTCTGGGCGATCAGAG
AGCAGTAG