SecReT6
Protein ID: 374331193
SecReT6 ID534
T6SS typei3
Gene symbol-
Locus tagPSE_2847
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3041643..3042056 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG8PRZ9
KEGG IDpsf:PSE_2847
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.50E-30, Aligned region: 4..119
Protein Sequence: 137 a.a.     [Download]
>gi|374331193|ref|YP_005081377.1| hypothetical protein PSE_2847 [Pseudovibrio sp. FO-BEG1]
MPVMITTTVIADKELNQNAEGMSTPVQVKIFYLTSDAEFKTHDFFTLFEKGDQVLGKNLLDMKEVFIAPG
KIMKVAVKVDPSVAFVAVLGAFRKVDTGTWSSVIMVPNNKPSSLIAYLSKLEITLQPDKTVKEGWFY
 
Nucleotide Sequence: 414 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3042056-3041643 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGCCTGTCATGATCACGACTACTGTCATCGCGGACAAGGAACTGAACCAGAACGCAGAAGGCATGTCGA
CACCTGTTCAGGTCAAGATCTTTTATCTTACTTCTGATGCCGAGTTTAAAACTCATGACTTTTTCACTCT
GTTTGAAAAAGGAGACCAAGTTCTCGGCAAAAACCTGCTGGATATGAAGGAAGTTTTCATAGCTCCCGGA
AAGATCATGAAGGTAGCAGTCAAGGTTGATCCGAGTGTGGCTTTCGTTGCTGTGCTTGGTGCCTTTCGGA
AAGTGGATACAGGGACCTGGAGCTCGGTGATTATGGTTCCAAACAACAAACCATCGAGCCTCATCGCTTA
CTTGAGCAAGCTTGAAATTACTCTGCAGCCCGACAAGACAGTAAAAGAAGGATGGTTCTATTAA