SecReT6
Protein ID: 374331194
SecReT6 ID534
T6SS typei3
Gene symbolfha
Locus tagPSE_2848
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3042127..3042786 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDG8PS00
KEGG IDpsf:PSE_2848
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.30E-13, Aligned region: 1..51
FHA [PF00498], Evalue: 7.30E-13, Aligned region: 52..73
Protein Sequence: 219 a.a.     [Download]
>gi|374331194|ref|YP_005081378.1| FHA domain-containing protein [Pseudovibrio sp. FO-BEG1]
MSRRHCIIEWHEGGYRVVDTSSNGTFVNDWDEPIPNGEACGLEEGDIIRIGGYYISTQFLPEGADARLKT
DDFLDAPENPDPLADLLPKELESEDDDWVDDQIVSSEDELSEVLNDPLESPESILRKATETLDSYPASEG
KEPIPPVSYGFEGYKYSSSVPFESDSGISSEEGASAWDHNRTESDAFKLPRTHHQTIPEDWDVEPKKDIE
NKARKPHDD
 
Nucleotide Sequence: 660 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3042786-3042127 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
TTGTCACGCCGTCATTGCATTATTGAGTGGCATGAAGGCGGGTATCGCGTTGTTGACACTAGCTCCAACG
GAACATTCGTCAATGACTGGGATGAGCCTATTCCGAACGGCGAAGCTTGTGGTTTGGAGGAAGGCGACAT
CATCCGCATTGGCGGCTATTACATCAGCACCCAGTTTCTGCCCGAAGGTGCCGATGCACGGCTGAAAACC
GATGATTTCCTGGATGCTCCAGAAAATCCTGATCCACTTGCGGATCTGCTTCCCAAAGAACTTGAGAGTG
AAGATGATGACTGGGTTGATGACCAGATTGTGTCTTCTGAGGACGAACTCTCTGAAGTTCTGAATGACCC
GCTTGAGTCTCCTGAGTCCATCCTTCGCAAAGCTACTGAAACGCTGGACTCCTATCCTGCTAGCGAAGGA
AAAGAGCCAATTCCACCAGTGAGTTATGGCTTTGAAGGTTACAAATACTCAAGCTCTGTACCTTTTGAAA
GCGACAGCGGCATTTCCAGCGAAGAAGGTGCAAGTGCCTGGGACCACAATCGTACTGAATCTGACGCCTT
TAAATTACCTAGAACGCATCACCAGACCATTCCGGAGGACTGGGATGTAGAACCGAAAAAAGACATTGAG
AACAAAGCTCGTAAACCACATGACGATTAG