SecReT6
Protein ID: 374331195
SecReT6 ID534
T6SS typei3
Gene symbol-
Locus tagPSE_2849
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3042947..3043063 [-]
Producthypothetical protein
NotePAAR
UniProt IDG8PS01
KEGG IDpsf:PSE_2849
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.00E-05, Aligned region: 2..29
Protein Sequence: 38 a.a.     [Download]
>gi|374331195|ref|YP_005081379.1| hypothetical protein PSE_2849 [Pseudovibrio sp. FO-BEG1]
MKGSVTTLIVGLPAARMLDVTAHGGTIILGWPTVLIGG
 
Nucleotide Sequence: 117 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3043063-3042947 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGAAAGGCAGTGTCACCACTTTGATCGTCGGATTGCCGGCGGCGCGTATGCTGGATGTCACTGCCCATG
GCGGCACCATCATCCTTGGCTGGCCCACAGTACTTATCGGGGGCTGA