SecReT6
Protein ID: 374331197
SecReT6 ID534
T6SS typei3
Gene symbol-
Locus tagPSE_2851
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3043836..3045944 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG8PSP6
KEGG IDpsf:PSE_2851
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-80, Aligned region: 32..335
Phage_GPD [PF05954], Evalue: 1.90E-80, Aligned region: 639..687
Phage_base_V [PF04717], Evalue: 1.10E-24, Aligned region: 274..287
Phage_base_V [PF04717], Evalue: 1.10E-24, Aligned region: 377..470
DUF2345 [PF10106], Evalue: 4.20E-06, Aligned region: 562..666
Gp5_C [PF06715], Evalue: 0.0001, Aligned region: 515..526
Gp5_C [PF06715], Evalue: 0.0001, Aligned region: 533..556
Gp5_C [PF06715], Evalue: 0.0001, Aligned region: 550..569
Gp5_C [PF06715], Evalue: 0.0001, Aligned region: 562..583
Gp5_C [PF06715], Evalue: 0.0001, Aligned region: 576..588
Gp5_C [PF06715], Evalue: 0.0001, Aligned region: 670..685
Protein Sequence: 702 a.a.     [Download]
>gi|374331197|ref|YP_005081381.1| Rhs element Vgr protein [Pseudovibrio sp. FO-BEG1]
MCASKVTENRLFTINFDGGDDSFHLWKMKMTSEMSELYEMVVDCRSFEHDLPLDKMLGQSLTLEMKKVSG
TSLSSDQYLNGFVTKAIYTGQDHGYSTYRLLVRPWLWFLTLTSNCRIFQEKSTPDILKEVFQDAGFTDFK
NKLSDSYDPRPYCVQFQESDFNFVCRLMEQEGIYYYFEHEDGQHTMILADAYSAHEDIKGESSLPFYSEE
DHFRRAADHLWDWRHNEEIQTDEVEINDYDFTKPTSDLKANASDKKSHQLSGRTRYMYPGDYEEVSAGEK
RAKIRVEEASAAYAKVYARGNARGLRPGYLFKLDKFPDDPSQEKEYLITKAVCEVSIEFARDEEQEFYDA
ITYEIEAIDSSVQYRRASTTPWPNMSGLQSAVVTGADGEEIWTDEYGRIKVQFHWDRDGQNDDKSSCWVR
VAQMWAGKSWGGLHIPRVGQEVLIDFLDGNPDRPIVVGSVYNGEQTVPYDLPSEATKSTIKSETSKEGGG
NNEFLFEDKKDEELVQLTAEKDYERTVKNNETVKIGFDKQEDGDQTIEVYNNRSLTVDQGDETYTIKTGG
RTTTVEKDDALSVKSGNHTITVESGDQSISMKQGAQTVEAMKDIGVTSQTGDVKVDASAGSVKVSGTQAI
ELTCGGSSIKMDPMSITLTAGPSSLKLEAAQAELKGLMVTVKGDVQATVDGTLTTLKGAGITTVQGALVK
IN
 
Nucleotide Sequence: 2109 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3045944-3043836 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGTGTGCAAGCAAAGTAACTGAGAACCGGCTGTTCACGATCAATTTCGATGGCGGAGATGACAGCTTCC
ATCTTTGGAAGATGAAAATGACCAGCGAAATGAGTGAGCTTTATGAAATGGTCGTCGATTGCCGATCATT
TGAACATGACCTGCCCCTCGATAAAATGCTTGGGCAGTCCCTCACTTTGGAAATGAAAAAGGTCTCTGGC
ACCAGTCTGTCTTCAGATCAATATCTGAACGGATTTGTGACCAAAGCAATCTATACCGGTCAGGATCACG
GATACTCGACATATCGACTTTTAGTGCGCCCGTGGCTCTGGTTTTTGACACTGACCAGCAACTGCCGAAT
TTTTCAGGAAAAGTCGACACCGGATATTTTGAAGGAAGTGTTCCAGGATGCTGGGTTTACGGACTTCAAG
AACAAACTGAGCGACAGTTACGATCCTCGCCCCTATTGTGTGCAGTTTCAAGAGAGTGACTTCAACTTTG
TCTGCCGACTCATGGAACAGGAAGGTATTTACTACTACTTCGAACATGAAGACGGCCAGCACACTATGAT
TCTTGCGGATGCGTATAGTGCGCACGAGGACATCAAAGGCGAGTCAAGTCTTCCATTCTATTCAGAGGAA
GATCACTTCCGCCGAGCAGCAGACCACCTTTGGGACTGGCGACATAACGAAGAGATCCAGACTGATGAAG
TAGAGATCAACGACTATGACTTCACAAAGCCAACCAGTGATTTGAAAGCCAACGCAAGCGATAAGAAATC
GCATCAGCTTTCTGGTCGCACGCGCTACATGTATCCCGGCGATTATGAAGAAGTCAGTGCAGGTGAAAAG
CGTGCGAAAATACGCGTGGAAGAAGCTTCAGCCGCCTACGCCAAGGTTTATGCCCGCGGTAACGCGCGAG
GCCTACGCCCCGGCTATCTCTTCAAACTGGACAAGTTCCCAGACGATCCAAGTCAGGAAAAAGAGTATCT
GATTACCAAGGCTGTTTGCGAGGTCTCTATCGAGTTTGCGCGTGACGAGGAACAAGAGTTCTACGATGCA
ATCACCTATGAGATCGAAGCGATCGACTCCAGTGTTCAGTACCGCAGAGCCTCGACGACACCCTGGCCAA
ACATGAGCGGCCTGCAGTCTGCTGTTGTTACAGGTGCAGATGGTGAAGAGATCTGGACTGATGAGTATGG
CCGGATCAAGGTACAATTCCATTGGGACCGTGACGGCCAGAACGACGACAAGTCATCCTGCTGGGTACGC
GTTGCTCAGATGTGGGCCGGTAAGAGTTGGGGGGGCTTACACATTCCACGCGTAGGACAGGAGGTTCTTA
TCGACTTCCTGGATGGAAATCCTGACCGCCCTATTGTGGTAGGCAGTGTCTATAATGGCGAGCAGACTGT
TCCCTATGACCTTCCCAGTGAAGCAACCAAATCCACGATCAAGAGTGAAACCTCCAAAGAAGGCGGAGGT
AACAACGAGTTCCTGTTTGAAGACAAAAAGGACGAAGAACTCGTTCAGCTTACCGCTGAGAAGGACTACG
AGCGAACCGTCAAGAACAACGAGACGGTCAAGATCGGGTTCGACAAGCAGGAGGATGGTGATCAGACCAT
CGAGGTTTACAACAACCGTAGCCTGACCGTTGATCAAGGTGACGAGACCTACACCATCAAGACCGGTGGC
CGCACGACCACGGTTGAAAAAGATGACGCCCTGTCCGTCAAATCCGGCAATCACACCATCACGGTTGAGA
GTGGTGATCAGTCGATCTCCATGAAACAAGGCGCGCAGACTGTTGAAGCAATGAAAGACATCGGTGTCAC
CTCGCAAACTGGTGATGTGAAAGTCGACGCCTCAGCCGGTTCGGTCAAAGTGTCTGGCACGCAGGCCATC
GAACTGACGTGCGGCGGCAGCTCAATCAAAATGGATCCCATGTCGATCACTCTGACAGCTGGCCCAAGTT
CTCTCAAACTGGAAGCGGCTCAGGCAGAGCTGAAAGGTTTGATGGTGACCGTTAAGGGTGATGTTCAGGC
GACCGTCGACGGAACTCTGACCACCTTAAAAGGTGCTGGCATCACGACGGTACAAGGTGCCCTCGTCAAG
ATTAATTGA