SecReT6
Protein ID: 374331199
SecReT6 ID534
T6SS typei3
Gene symbol-
Locus tagPSE_2853
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3046289..3048286 [-]
Producthypothetical protein
NoteTssC
UniProt IDG8PSP8
KEGG IDpsf:PSE_2853
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.20E-62, Aligned region: 233..518
DUF770 [PF05591], Evalue: 8.10E-06, Aligned region: 55..152
Utp12 [PF04003], Evalue: 0.0083, Aligned region: 220..277
Utp12 [PF04003], Evalue: 0.0083, Aligned region: 333..392
Protein Sequence: 665 a.a.     [Download]
>gi|374331199|ref|YP_005081383.1| hypothetical protein PSE_2853 [Pseudovibrio sp. FO-BEG1]
MNDAEKDDDLDSLLNDIIEESDAPAEGGSAESASASVFEPDFGEIDCEAPKLNITLESPFHLAVIGDFSG
RANRMALYTADELAVLKGHNVDVDTAEDLPARFKINIELDLAGDDKVIRFEPRCIEDFHPDEIIEEFEIF
DELKALRSSLKNPGTFSSAAATIDEWLENQGEKPVSQRNSRGSVIAVDKKLSDFSALIDRPVEEHEEVDD
LSEMIGKMVSPYIKAADNPQLDDYLEIVEEVMTTTLRKILQNADFQALESVWRVIDMLSRRIETSTSLKI
TLYDISAEDFARDLSATNKLEETGLYRLFVENALQDEGVGTPSAIVGLYTFDMTPPHAELLGRMSKICAH
AHAPFLTSLDRNNANRKFEELPKITEKTWQSLKAMPESNYIGLSLPRFMLRMPYGAKTDPIDAFDFEEFD
EKIGLKAMLWGNPAALVGLVLAKDYETNGGGMRPGSILTINDMPFHYVHDQYGDQVALPCTDRMISHRSV
EPLMRQRFMPIVSMKGQPEVRIASLSGLAGDIVSGRWCDQIAVSKAAETPSASAGARVSIAGGDGYNPAI
QATKGAVVVETILDPKKTPETVFRIETETPEPQVKEPAAAEDEDEDVEEAAPAPAPKPAAAAAPPEPAHD
TSELDNLLADLSADDEDEADEEGMDPELEALLADL
 
Nucleotide Sequence: 1998 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3048286-3046289 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGAATGACGCTGAAAAAGACGATGACCTTGACTCGCTGCTTAACGACATCATCGAGGAAAGTGACGCCC
CTGCCGAAGGTGGAAGTGCCGAGAGCGCTTCTGCCAGCGTGTTTGAACCAGATTTTGGCGAGATCGACTG
CGAAGCGCCAAAGCTGAACATTACGCTGGAAAGCCCCTTCCATCTGGCGGTCATTGGCGATTTCTCAGGC
CGTGCCAATCGGATGGCGCTTTATACAGCAGATGAGCTTGCTGTGCTTAAAGGCCATAATGTTGATGTTG
ATACGGCAGAAGATCTCCCAGCCCGTTTTAAGATCAACATTGAGCTGGACCTTGCAGGTGATGACAAGGT
TATCCGGTTTGAACCACGCTGCATTGAAGACTTCCATCCCGATGAGATCATCGAAGAGTTCGAGATCTTT
GATGAGCTGAAAGCTCTGCGATCTTCTTTGAAGAACCCAGGGACCTTCAGCAGCGCAGCTGCAACCATTG
ATGAATGGCTGGAAAACCAGGGCGAGAAGCCTGTTTCTCAGCGGAACTCCCGCGGCTCTGTGATTGCCGT
TGACAAGAAGCTCAGTGACTTTTCTGCTTTGATTGACCGGCCTGTCGAAGAGCATGAAGAAGTCGATGAT
CTTTCCGAAATGATCGGCAAAATGGTCTCGCCTTACATCAAAGCAGCCGACAATCCGCAGCTCGACGATT
ATCTTGAGATCGTTGAGGAAGTGATGACGACAACCCTTCGCAAGATCCTGCAAAATGCAGATTTTCAGGC
ATTGGAGAGTGTCTGGCGGGTTATTGATATGTTGTCACGCCGGATTGAGACTTCCACATCCTTGAAGATC
ACGCTCTACGACATTTCAGCGGAAGATTTTGCTCGTGACCTGAGCGCGACCAACAAGCTGGAAGAAACAG
GTCTGTATCGTCTGTTCGTAGAAAATGCACTGCAGGATGAAGGTGTTGGCACGCCAAGTGCTATCGTGGG
CCTTTACACATTCGACATGACACCTCCGCATGCGGAGCTTCTTGGTCGCATGTCAAAGATCTGTGCTCAT
GCTCATGCGCCGTTCCTGACTTCTCTGGATCGCAACAACGCAAACAGAAAATTTGAAGAGCTTCCTAAGA
TTACCGAAAAGACGTGGCAGAGTCTTAAGGCTATGCCAGAGAGCAATTACATTGGTCTGAGCTTGCCACG
CTTCATGCTTCGGATGCCCTATGGAGCAAAAACCGATCCGATTGATGCATTCGACTTTGAAGAGTTTGAC
GAGAAGATTGGCCTGAAAGCCATGTTGTGGGGTAACCCGGCAGCACTGGTCGGCCTTGTGCTCGCAAAAG
ACTATGAGACCAATGGTGGCGGCATGCGGCCAGGTTCGATCCTGACCATCAACGATATGCCGTTCCATTA
CGTGCATGACCAGTACGGCGATCAAGTCGCCCTGCCCTGTACAGACCGCATGATCAGTCACCGCAGCGTT
GAACCTTTGATGCGACAGCGGTTCATGCCGATTGTTTCCATGAAAGGACAGCCGGAAGTCCGGATCGCCT
CTCTGAGTGGCCTTGCCGGAGATATTGTTTCCGGTCGCTGGTGTGATCAGATTGCGGTTTCCAAAGCAGC
AGAAACCCCAAGCGCAAGTGCTGGTGCGCGCGTCAGCATTGCTGGCGGTGACGGTTATAACCCTGCCATT
CAGGCAACGAAGGGTGCTGTGGTTGTTGAAACCATCCTGGATCCTAAGAAGACCCCGGAAACCGTCTTCA
GGATCGAAACAGAAACACCTGAACCTCAAGTTAAAGAACCTGCGGCTGCAGAAGACGAGGACGAAGACGT
CGAAGAAGCAGCTCCGGCACCTGCACCAAAACCTGCAGCAGCGGCTGCTCCACCTGAACCTGCCCATGAC
ACATCTGAGCTGGACAACCTGCTAGCTGATCTATCTGCAGATGATGAAGACGAAGCTGACGAAGAAGGTA
TGGATCCAGAGCTCGAAGCTCTGCTTGCCGACCTATAA