SecReT6
Protein ID: 374331201
SecReT6 ID534
T6SS typei3
Gene symbolclpV
Locus tagPSE_2855
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3049297..3051891 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDG8PSQ0
KEGG IDpsf:PSE_2855
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-38, Aligned region: 201..224
AAA_2 [PF07724], Evalue: 1.50E-38, Aligned region: 583..748
AAA [PF00004], Evalue: 1.50E-19, Aligned region: 201..333
AAA [PF00004], Evalue: 1.50E-19, Aligned region: 589..694
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 201..221
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 300..331
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 588..699
ClpB_D2-small [PF10431], Evalue: 8.80E-12, Aligned region: 756..833
AAA_16 [PF13191], Evalue: 3.40E-11, Aligned region: 10..32
AAA_16 [PF13191], Evalue: 3.40E-11, Aligned region: 178..221
AAA_16 [PF13191], Evalue: 3.40E-11, Aligned region: 246..279
AAA_16 [PF13191], Evalue: 3.40E-11, Aligned region: 475..515
AAA_16 [PF13191], Evalue: 3.40E-11, Aligned region: 579..629
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 23..69
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 200..286
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 325..367
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 586..611
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 650..674
Sigma54_activat [PF00158], Evalue: 6.50E-08, Aligned region: 179..215
Sigma54_activat [PF00158], Evalue: 6.50E-08, Aligned region: 559..705
AAA_25 [PF13481], Evalue: 8.80E-07, Aligned region: 187..264
AAA_25 [PF13481], Evalue: 8.80E-07, Aligned region: 325..370
AAA_25 [PF13481], Evalue: 8.80E-07, Aligned region: 585..613
AAA_19 [PF13245], Evalue: 1.80E-06, Aligned region: 200..222
AAA_19 [PF13245], Evalue: 1.80E-06, Aligned region: 342..378
AAA_19 [PF13245], Evalue: 1.80E-06, Aligned region: 586..610
AAA_17 [PF13207], Evalue: 7.00E-06, Aligned region: 201..261
AAA_17 [PF13207], Evalue: 7.00E-06, Aligned region: 336..371
AAA_17 [PF13207], Evalue: 7.00E-06, Aligned region: 587..623
IstB_IS21 [PF01695], Evalue: 1.00E-05, Aligned region: 183..222
IstB_IS21 [PF01695], Evalue: 1.00E-05, Aligned region: 588..607
IstB_IS21 [PF01695], Evalue: 1.00E-05, Aligned region: 827..853
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 179..215
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 254..355
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 587..609
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 658..670
Clp_N [PF02861], Evalue: 3.90E-05, Aligned region: 2..46
Clp_N [PF02861], Evalue: 3.90E-05, Aligned region: 78..96
AAA_14 [PF13173], Evalue: 5.40E-05, Aligned region: 201..304
AAA_14 [PF13173], Evalue: 5.40E-05, Aligned region: 587..669
NACHT [PF05729], Evalue: 0.0001, Aligned region: 201..228
NACHT [PF05729], Evalue: 0.0001, Aligned region: 588..616
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 200..221
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 582..628
AAA_18 [PF13238], Evalue: 0.00017, Aligned region: 201..225
AAA_18 [PF13238], Evalue: 0.00017, Aligned region: 589..617
AAA_18 [PF13238], Evalue: 0.00017, Aligned region: 777..803
AAA_29 [PF13555], Evalue: 0.00049, Aligned region: 194..217
AAA_29 [PF13555], Evalue: 0.00049, Aligned region: 586..613
T2SE [PF00437], Evalue: 0.0016, Aligned region: 183..217
T2SE [PF00437], Evalue: 0.0016, Aligned region: 572..661
DUF815 [PF05673], Evalue: 0.0074, Aligned region: 175..276
DUF815 [PF05673], Evalue: 0.0074, Aligned region: 546..627
DUF258 [PF03193], Evalue: 0.008, Aligned region: 196..218
DUF258 [PF03193], Evalue: 0.008, Aligned region: 586..602
Hpr_kinase_C [PF07475], Evalue: 0.0085, Aligned region: 201..213
Hpr_kinase_C [PF07475], Evalue: 0.0085, Aligned region: 586..607
RNA_helicase [PF00910], Evalue: 0.0088, Aligned region: 202..222
RNA_helicase [PF00910], Evalue: 0.0088, Aligned region: 589..610
RNA_helicase [PF00910], Evalue: 0.0088, Aligned region: 686..707
Protein Sequence: 864 a.a.     [Download]
>gi|374331201|ref|YP_005081385.1| type VI secretion ATPase, ClpV1 family [Pseudovibrio sp. FO-BEG1]
MRGNPYVELEHWFQQLLSAQDSDLHRIIRDAGIDEARLASDLTKALDKLPRGASSVSDLSQHVEEAVERG
WVYATLMFGDNAIRSGYLLIGILKTPGLRNTLFGISRLFENISADDTAARYKKITEGSPEEGKAKDGTQL
DAGEQHAAAPGLKTADEALDAYCTDVTAKAKEGQLDPVIGREEEIRQIIDTLMRRRQNNPILTGEAGVGK
TAVVEGLAIRIAEGDVPPSIKDVRVLLLDVGLLQAGAGVKGEFEDRLRKILDAVRSSVQPIILFIDEAHT
LIGAGGAAGTGDAANLLKPALARGELRTIAATTWSEYKKHIEKDPALARRFQNILVEEPDPDKAVAIMRG
VAAMLEKHHQVQILDEALEAAVHLSMRFIPARQLPDKAISLIDTACARVALSQHATPAAVDDCRKRQVMV
ETERDILERESQSGFDVGEKLTDVKKKLTELEKEREGLEAEWIKEQTLVGDILKLREVFRQTNGDENADT
APVKKELDEKLEELTELQGEHPLILPEVDAQAVATIVSDWTGIPTGRMVSNEINTVLHLSDILRKRIIGQ
DHAMEVIARRVKTSRANLDNPSRPIGVFLLVGPSGVGKTETALALAETLYGGEQNLITINMSEFQESHTV
STLKGSPPGYVGYGEGGVLTEAVRRRPYSIVLLDEVEKAHPDVHELFFQVFDKGMMEDGEGRKINFKNTL
ILLTANVGSDLILDMCADEDLVPDPDGIAKALRPPLLKAFPAALLGRLVTVPYYPLSSPVIHKIINLQLG
RIGDRILENHNVKFTWDDSVVKLIESRCAEIESGGRMIDAILTNTLLPDISTEFLKNMSEDKKITELKVH
TDGDAFDYKFKKSPVAKKDKHKKK
 
Nucleotide Sequence: 2595 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3051891-3049297 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGCGCGGCAATCCCTATGTGGAGTTGGAACATTGGTTCCAGCAGCTTCTGAGTGCACAGGATTCAGATT
TACACCGTATCATTCGCGATGCGGGTATCGATGAGGCACGGCTTGCGTCGGATCTCACCAAGGCTTTGGA
CAAACTCCCGCGCGGCGCAAGTTCTGTCAGCGACCTTTCCCAACACGTGGAGGAAGCGGTTGAACGTGGC
TGGGTTTATGCCACGCTGATGTTTGGCGACAACGCCATCCGCAGTGGCTATCTCCTGATTGGCATTCTCA
AGACCCCAGGCCTGCGCAACACCCTGTTTGGCATCTCTCGGTTGTTTGAGAACATATCTGCAGACGATAC
AGCAGCCCGTTACAAGAAGATTACGGAAGGCTCTCCTGAGGAAGGTAAAGCCAAGGATGGTACGCAACTG
GATGCAGGTGAGCAACATGCTGCAGCTCCTGGATTAAAGACTGCAGATGAAGCCCTTGATGCTTACTGCA
CGGATGTGACTGCCAAGGCAAAAGAAGGCCAGCTGGATCCTGTTATTGGCCGCGAAGAAGAAATCCGGCA
GATCATTGATACGCTGATGCGCCGCCGCCAGAACAACCCTATCCTGACGGGTGAAGCCGGTGTTGGTAAA
ACTGCTGTTGTTGAAGGTCTGGCGATCCGCATTGCAGAGGGCGATGTGCCACCGTCCATCAAAGACGTTC
GTGTTCTGCTGCTGGATGTGGGTCTGCTTCAGGCCGGTGCTGGTGTTAAAGGTGAGTTTGAAGATCGTCT
GCGCAAGATTTTGGATGCGGTTCGCTCCTCTGTACAGCCGATTATTCTGTTCATCGACGAAGCCCATACA
CTGATTGGTGCTGGTGGCGCCGCTGGTACCGGTGATGCCGCGAACCTGCTGAAACCGGCTTTGGCTCGTG
GTGAGTTGCGGACGATCGCGGCGACCACATGGTCAGAATACAAGAAGCATATTGAGAAAGACCCAGCTCT
TGCTCGCCGGTTCCAGAACATTCTGGTTGAAGAGCCAGATCCGGATAAAGCCGTTGCCATTATGCGTGGA
GTAGCAGCAATGCTTGAAAAGCACCATCAGGTGCAGATCCTTGATGAAGCATTGGAAGCTGCAGTTCACC
TTTCCATGCGCTTTATTCCAGCTCGGCAATTGCCCGACAAAGCAATCAGTTTGATTGATACGGCCTGTGC
CCGCGTTGCCCTTTCCCAACACGCCACACCGGCAGCAGTGGATGATTGCCGAAAGCGGCAAGTGATGGTG
GAGACAGAGCGAGACATTCTGGAACGCGAGTCTCAATCTGGTTTTGATGTAGGTGAGAAGCTCACCGACG
TTAAAAAGAAACTGACCGAACTTGAGAAAGAACGCGAAGGTCTAGAAGCTGAGTGGATCAAAGAGCAAAC
GCTCGTTGGGGACATTCTGAAACTACGTGAGGTATTCCGCCAAACCAATGGCGATGAGAATGCCGATACA
GCGCCAGTTAAGAAAGAGCTCGACGAGAAACTAGAAGAGCTGACGGAGCTTCAAGGCGAGCATCCGCTCA
TTTTGCCAGAGGTAGACGCTCAGGCGGTTGCCACCATTGTTTCTGACTGGACTGGCATTCCAACAGGCCG
AATGGTTTCCAATGAAATCAACACCGTCCTCCATCTGAGCGATATTCTGCGCAAGCGGATTATTGGTCAG
GACCATGCGATGGAAGTAATTGCACGCCGTGTGAAGACCTCCCGCGCCAATCTGGATAATCCAAGCCGCC
CAATCGGTGTTTTCCTGCTTGTGGGTCCAAGTGGTGTCGGTAAGACTGAAACCGCTCTGGCCCTTGCCGA
GACGCTTTATGGCGGAGAACAGAACCTCATTACAATCAACATGAGTGAGTTTCAGGAGAGCCATACTGTT
TCGACTCTGAAGGGCTCACCTCCGGGTTATGTGGGTTACGGTGAAGGCGGCGTTCTGACAGAAGCTGTGC
GCCGCAGACCTTATAGCATCGTGCTGCTTGATGAGGTTGAGAAGGCCCACCCAGATGTGCACGAGCTGTT
CTTCCAGGTTTTTGATAAAGGTATGATGGAAGATGGTGAAGGGCGGAAGATCAACTTCAAGAACACGCTG
ATCCTTCTCACCGCGAACGTGGGCAGTGATCTCATACTGGATATGTGTGCTGACGAAGATCTGGTGCCGG
ATCCGGATGGCATTGCCAAGGCTTTGAGACCTCCGCTTCTCAAGGCCTTCCCAGCCGCCTTGCTCGGTCG
TCTTGTGACTGTGCCTTACTACCCACTCAGCTCACCAGTTATTCATAAGATCATCAACCTGCAGCTTGGC
CGCATTGGTGATCGTATTCTTGAGAACCACAATGTGAAGTTCACCTGGGATGACTCTGTTGTGAAGCTGA
TTGAAAGCAGGTGTGCTGAGATTGAGAGTGGTGGCCGCATGATTGATGCGATCCTGACCAACACGCTGCT
GCCTGATATCAGCACCGAGTTCCTCAAGAACATGAGCGAAGACAAGAAGATCACAGAGCTCAAAGTGCAT
ACAGATGGTGATGCCTTTGACTACAAGTTCAAGAAGTCACCTGTGGCGAAAAAGGATAAGCATAAGAAGA
AGTGA