SecReT6
Protein ID: 374331202
SecReT6 ID534
T6SS typei3
Gene symbol-
Locus tagPSE_2856
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3051987..3053153 [-]
Producthypothetical protein
NoteTssG
UniProt IDG8PSQ1
KEGG IDpsf:PSE_2856
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.90E-100, Aligned region: 53..352
Protein Sequence: 388 a.a.     [Download]
>gi|374331202|ref|YP_005081386.1| hypothetical protein PSE_2856 [Pseudovibrio sp. FO-BEG1]
MTGSQTPPPSIGPPPKPTPPNGANKVPAVTQQPPTQEARWRGRLRSAEKDFLDYEFLPLVRLIECANPDK
PRIGTSRRCQDDPVRFSHEPHLQFEASTITAFKQGVGTNPSRMTSRFLGLFGPNGPMPLHLTEYAFKREH
QHRDTTMRAFADVFHHRILSLFYRAAITGEPAFSFDRPEQDRYSIYTGALAGFGPTEFRHRDDLPDVVKY
HFAGRLALQTRGADGLLAILSCYFNLPVELEEFIGEWLYLPKKQVTALNGFRNAGLLGVGAALGGRVWSS
DTKFRVAFGPLSLRDYEGLLPDGISMPRLLSAVRAYCGDELEWDVALVLKRNQVPTTRLGQYGKLGWTTW
LSPKKQGGPVRDLNLRPRQVTEKSKKASVHSNGSAKAA
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3053153-3051987 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGACTGGTTCCCAGACACCTCCTCCCTCTATTGGTCCGCCGCCAAAACCGACGCCTCCCAATGGTGCAA
ACAAGGTCCCTGCGGTAACACAGCAGCCTCCAACACAGGAAGCGCGCTGGAGGGGGCGTTTGCGTTCGGC
TGAGAAAGACTTTCTCGACTACGAGTTCTTGCCTCTGGTCCGGCTTATTGAATGTGCCAATCCAGACAAG
CCCCGCATCGGGACATCCCGCCGATGTCAGGATGACCCTGTTCGGTTCTCTCATGAGCCGCATTTGCAGT
TTGAAGCTTCGACGATCACAGCTTTCAAGCAGGGTGTTGGCACTAATCCAAGTCGAATGACCAGCCGTTT
CCTCGGTCTCTTTGGCCCGAATGGGCCGATGCCCCTGCATCTGACCGAATATGCGTTTAAGCGAGAGCAT
CAGCACCGCGATACGACCATGCGGGCGTTTGCGGATGTGTTTCATCACCGCATTCTCAGCCTGTTTTATC
GGGCCGCAATCACCGGTGAACCTGCCTTCAGCTTTGATCGACCTGAACAGGATCGGTATTCAATCTATAC
CGGAGCACTGGCAGGCTTTGGGCCGACAGAATTCCGGCATCGAGATGATCTGCCAGACGTGGTGAAGTAC
CACTTTGCGGGACGGCTCGCACTTCAAACACGTGGTGCAGATGGTCTGCTGGCGATCCTCAGCTGTTACT
TCAACCTCCCCGTTGAGCTTGAAGAGTTTATTGGTGAGTGGCTCTACTTACCTAAGAAGCAGGTGACTGC
GCTCAATGGTTTCCGCAACGCTGGCCTTCTTGGAGTTGGTGCAGCTTTGGGTGGTCGTGTTTGGTCCAGC
GACACCAAGTTTCGTGTTGCATTTGGACCGCTTTCTCTGCGCGATTACGAAGGTTTGTTGCCTGACGGCA
TTTCCATGCCGCGGCTGCTTTCTGCTGTTCGTGCCTATTGTGGTGATGAGCTGGAATGGGATGTGGCTTT
GGTACTTAAACGCAACCAGGTGCCCACAACTCGTCTGGGTCAATACGGAAAACTTGGTTGGACCACGTGG
CTCTCGCCCAAGAAACAGGGTGGCCCGGTTCGAGATCTCAATTTGCGCCCACGTCAAGTTACTGAAAAAT
CAAAAAAAGCGTCTGTTCATAGCAACGGTAGTGCGAAGGCTGCCTAG