SecReT6
Protein ID: 374331203
SecReT6 ID534
T6SS typei3
Gene symbol-
Locus tagPSE_2857
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3053150..3055027 [-]
ProductType VI secretion system
NoteTssF
UniProt IDG8PSQ2
KEGG IDpsf:PSE_2857
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.30E-215, Aligned region: 5..623
Protein Sequence: 625 a.a.     [Download]
>gi|374331203|ref|YP_005081387.1| Type VI secretion system [Pseudovibrio sp. FO-BEG1]
MKPWLLPYYNRELQHIRESASEFAEAYPKVAGRLGLSGFDCADPYVERLLEGFAFLTARVQYKLDAQFPQ
FTQHLLEMVYPHFLAPVPSMLIASLEPDMTQGSLKEGYLVPRGTQLRSRKSARGATPCTYKTAHDTTLWP
VSVEAVDYLASPSELAAQKVEVRNGAKAGLRIRLKTVGNIPFNELALDELPLYLRGGGSQPVKLYEQIIG
NCAGVAIRPTSLPTPWEINLPSEIVNTRGYGDEDALLPYGPQSFSGYRLLQEYFAFPHRFLFAELTNLQP
AVRQCETDEMDVFLLFNRVDRDLERAVDRANIALFCTPAINLFSTRLDRLHINDRRSDHHVVPDRSKPLD
YEIYQLEEVEGYSSQGDAPQIFKPFYSLSSSQDIRSESAYYTVHRKQRLATAKRKITGGRSNYLGTEIFI
SLVDAKDAPYNLSLNQLGIRALCTNRDLPLMMPIGAGKSDFSLPEGGPVNAVKCIDGPSRPRPSNIFGET
AWRFINHLSLNYLSIADNNDTDGAQALRSILHLYAPLGDTSTTQQIDGVRSIKSTRAVRRLPGRGLSSVA
RGLELNITLDEAAFEGTGVFLLGAVLNEFFARYVSINSFTETVVRSSVRGEVMRWPCQIGRRHRL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3055027-3053150 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGAAGCCTTGGCTGCTTCCTTATTACAACAGAGAATTACAGCACATACGCGAAAGTGCCTCAGAATTTG
CAGAGGCATATCCCAAGGTTGCAGGCCGTCTCGGGCTGAGTGGCTTTGACTGTGCAGACCCTTACGTGGA
GCGGTTACTAGAGGGCTTTGCGTTTCTGACAGCGCGCGTTCAATACAAGCTGGATGCTCAGTTCCCTCAG
TTTACGCAGCATCTTCTTGAGATGGTGTATCCGCATTTTCTGGCGCCCGTGCCATCCATGTTGATTGCCA
GCCTTGAGCCAGACATGACACAGGGCTCATTGAAGGAAGGCTATCTGGTTCCTCGCGGAACTCAATTGCG
CAGCCGGAAAAGTGCACGCGGAGCAACGCCTTGTACCTACAAGACGGCTCACGACACGACCTTATGGCCT
GTCAGCGTAGAAGCAGTCGACTATCTTGCGAGCCCGAGTGAACTGGCGGCACAGAAGGTTGAAGTGCGCA
ACGGTGCAAAGGCTGGACTTCGCATACGGCTGAAGACCGTTGGCAACATTCCCTTCAATGAATTGGCGCT
GGATGAACTCCCTCTCTATTTGCGAGGTGGCGGTTCACAGCCGGTGAAGCTCTACGAGCAGATTATCGGT
AACTGTGCGGGCGTTGCCATTCGCCCGACAAGCCTGCCGACACCATGGGAAATCAATCTCCCCTCTGAAA
TCGTGAACACACGCGGTTATGGAGATGAAGATGCTCTGCTCCCCTACGGCCCTCAATCTTTCAGCGGATA
TCGTTTGCTGCAGGAGTACTTTGCTTTTCCCCATAGGTTCCTGTTTGCAGAACTGACGAATCTACAACCA
GCTGTTCGCCAATGTGAAACCGATGAGATGGATGTTTTCCTGCTCTTCAATCGGGTTGACAGGGATCTGG
AGCGCGCCGTTGATCGCGCTAATATTGCGTTGTTTTGTACGCCAGCCATCAATCTGTTCTCCACGCGACT
GGATCGCTTGCACATAAACGACAGGCGCAGCGATCACCATGTGGTGCCGGATCGTTCCAAGCCGCTGGAC
TATGAGATCTATCAGCTGGAAGAAGTGGAAGGCTACAGCTCTCAGGGTGATGCGCCGCAGATCTTCAAGC
CATTTTACAGCCTCTCAAGTTCTCAGGATATTCGCAGTGAGAGCGCCTATTACACAGTTCATCGAAAACA
ACGCCTAGCAACCGCTAAGCGGAAGATTACGGGCGGTCGTAGTAACTATCTGGGCACCGAGATCTTCATC
AGTCTCGTAGATGCGAAAGATGCGCCGTATAATCTATCGCTCAATCAGCTGGGCATTCGCGCTCTTTGCA
CAAACCGCGACTTGCCGTTGATGATGCCGATTGGCGCAGGCAAATCAGACTTTTCGCTTCCAGAAGGTGG
TCCAGTTAATGCGGTGAAGTGTATTGACGGACCAAGCCGCCCTCGTCCCTCCAACATCTTTGGTGAAACG
GCATGGCGGTTCATCAACCATTTGTCACTGAACTACCTCAGCATTGCGGATAATAACGACACCGATGGAG
CACAAGCCTTGCGTTCCATTCTGCATCTTTATGCGCCGCTGGGAGATACCTCTACGACGCAGCAGATAGA
TGGTGTTCGATCTATCAAATCTACCCGAGCAGTGCGTCGTCTCCCTGGGCGTGGCCTCTCTTCTGTTGCC
CGTGGTCTGGAGCTGAACATTACGCTCGATGAAGCCGCGTTTGAAGGCACGGGTGTGTTTCTCTTGGGAG
CGGTGCTCAACGAGTTCTTCGCGCGTTACGTATCGATCAACAGCTTCACGGAAACCGTGGTGAGATCGAG
CGTTCGTGGTGAAGTGATGCGTTGGCCATGTCAGATTGGGAGGCGTCATAGGCTATGA