SecReT6
Protein ID: 374331204
SecReT6 ID534
T6SS typei3
Gene symbol-
Locus tagPSE_2858
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3055029..3055535 [-]
ProductType VI secretion system, lysozyme-related protein
NoteTssE
UniProt IDG8PSQ3
KEGG IDpsf:PSE_2858
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.60E-18, Aligned region: 37..143
Protein Sequence: 168 a.a.     [Download]
>gi|374331204|ref|YP_005081388.1| Type VI secretion system, lysozyme-related protein [Pseudovibrio sp. FO-BEG1]
MAERPLADRLVPSLLDRLTDDNPFQQVEPREARVTSSVNLRYSIQRDLEWLFNTTRLGSDINLTPYPEVQ
SSVLNFGIPDLGAMTTKSAEEIEDILHEAIVNFEPRVIEESLLVSIVEPNKPRRSNRLDFQIEGQLWSQP
LPQALYLRTEFDLDVHAVQIAKPRQRGS
 
Nucleotide Sequence: 507 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3055535-3055029 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGGCTGAACGGCCACTTGCTGATCGGTTGGTCCCGTCTTTGCTGGACCGTCTAACAGATGACAACCCGT
TTCAGCAGGTAGAGCCCCGTGAAGCCCGCGTCACCAGCTCGGTTAATCTTCGGTATTCCATTCAGCGTGA
TTTGGAGTGGCTTTTTAACACAACGCGACTTGGCTCCGACATCAATCTAACACCTTACCCTGAAGTCCAG
TCCTCCGTCTTAAACTTTGGAATTCCAGACCTTGGTGCGATGACAACCAAAAGTGCCGAGGAAATTGAAG
ACATCCTGCACGAAGCCATCGTCAACTTCGAGCCTCGCGTTATCGAAGAAAGTCTGCTGGTTTCCATCGT
TGAACCAAACAAGCCACGTCGTTCCAACCGTCTGGATTTTCAGATTGAAGGGCAGCTGTGGTCTCAACCT
TTGCCACAAGCTTTGTATCTGCGCACTGAGTTCGATCTTGATGTGCATGCAGTGCAGATAGCTAAACCGC
GCCAGCGAGGTTCCTGA